From: plugwash Date: Fri, 28 Mar 2008 02:26:58 +0000 (+0000) Subject: initial import X-Git-Url: http://www.lcore.org/git/lcore.git/commitdiff_plain/4782a5c5afee47721cc617daa40dd29828342c2b?ds=inline initial import git-svn-id: file:///svnroot/lcore/trunk@1 b1de8a11-f9be-4011-bde0-cc7ace90066a --- 4782a5c5afee47721cc617daa40dd29828342c2b diff --git a/Makefile b/Makefile new file mode 100755 index 0000000..2926076 --- /dev/null +++ b/Makefile @@ -0,0 +1,23 @@ +all: lcoretest + +lcoretest: *.pas *.inc lcoretest.dpr + fpc -Sd -dipv6 lcoretest.dpr + +clean: + -rm *.o + -rm *.ppu + -rm *.exe + -rm *.dcu + -rm lcoretest + +date := $(shell date +%Y%m%d) + +zip: + mkdir -p lcorewin32_$(date) + cp -a *.pas lcorewin32_$(date) + cp -a *.inc lcorewin32_$(date) + cp -a *.dpr lcorewin32_$(date) + cp -a Makefile lcorewin32_$(date) + -rm ../lcorewin32_$(date).zip + zip -r ../lcorewin32_$(date).zip lcorewin32_$(date) + rm -rf lcorewin32_$(date) \ No newline at end of file diff --git a/bfifo.pas b/bfifo.pas new file mode 100755 index 0000000..55cc24a --- /dev/null +++ b/bfifo.pas @@ -0,0 +1,148 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit bfifo; +{$ifdef fpc} + {$mode delphi} +{$endif} + +interface + +uses blinklist,pgtypes; + +const + pagesize=1420; + +type + tfifo=class(tobject) + private + l:tlinklist; {add to} + getl:tlinklist; {remove from} + ofs:integer; + getofs:integer; + public + size:integer; + procedure add(data:pointer;len:integer); + function get(var resultptr:pointer;len:integer):integer; + procedure del(len:integer); + constructor create; + destructor destroy; override; + end; + + +implementation + +var + testcount:integer; + +{ + +xx1..... add +xxxxxxxx +....2xxx delete + +1 ofs +2 getofs + +} + +procedure tfifo.add; +var + a:integer; + p:tlinklist; +begin + if len <= 0 then exit; + inc(size,len); + while len > 0 do begin + p := l; + if ofs = pagesize then begin + p := tplinklist.create; + if getl = nil then getl := p; + getmem(tplinklist(p).p,pagesize); + inc(testcount); + linklistadd(l,p); + ofs := 0; + end; + a := pagesize - ofs; + if len < a then a := len; + move(data^,pointer(taddrint(tplinklist(p).p)+ofs)^,a); + inc(taddrint(data),a); + dec(len,a); + inc(ofs,a); + end; +end; + +function tfifo.get; +var + p:tlinklist; + a:integer; +begin + if len > size then len := size; + if len <= 0 then begin + result := 0; + resultptr := nil; + exit; + end; + p := getl; + resultptr := pointer(taddrint(tplinklist(p).p)+getofs); + result := pagesize-getofs; + if result > len then result := len; +end; + +procedure tfifo.del; +var + a:integer; + p,p2:tlinklist; +begin + if len <= 0 then exit; + p := getl; + if len > size then len := size; + dec(size,len); + + if len = 0 then exit; + + while len > 0 do begin + a := pagesize-getofs; + if a > len then a := len; + inc(getofs,a); + dec(len,a); + if getofs = pagesize then begin + p2 := p.prev; + freemem(tplinklist(p).p); + dec(testcount); + linklistdel(l,p); + p.destroy; + p := p2; + getl := p; + getofs := 0; + end; + end; + + if size = 0 then begin + if assigned(l) then begin + p := l; + freemem(tplinklist(p).p); + dec(testcount); + linklistdel(l,p); + p.destroy; + getl := nil; + end; + ofs := pagesize; + getofs := 0; + end; +end; + +constructor tfifo.create; +begin + ofs := pagesize; + inherited create; +end; + +destructor tfifo.destroy; +begin + del(size); + inherited destroy; +end; + +end. diff --git a/binipstuff.pas b/binipstuff.pas new file mode 100755 index 0000000..ebb9f9c --- /dev/null +++ b/binipstuff.pas @@ -0,0 +1,395 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit binipstuff; + +interface + +{$ifndef win32} +{$ifdef ipv6} +uses sockets; +{$endif} +{$endif} + +{$ifdef fpc} + {$mode delphi} +{$endif} +{$ifdef cpu386}{$define i386}{$endif} +{$ifdef i386}{$define ENDIAN_LITTLE}{$endif} + +{$include uint32.inc} + +const + hexchars:array[0..15] of char='0123456789abcdef'; + AF_INET=2; + {$ifdef win32} + AF_INET6=23; + {$else} + AF_INET6=10; + {$endif} + +type + {$ifdef ipv6} + + {$ifdef win32} + {$define want_Tin6_addr} + {$endif} + {$ifdef ver1_0} + {$define want_Tin6_addr} + {$endif} + {$ifdef want_Tin6_addr} + Tin6_addr = packed record + case byte of + 0: (u6_addr8 : array[0..15] of byte); + 1: (u6_addr16 : array[0..7] of Word); + 2: (u6_addr32 : array[0..3] of uint32); + 3: (s6_addr8 : array[0..15] of shortint); + 4: (s6_addr : array[0..15] of shortint); + 5: (s6_addr16 : array[0..7] of smallint); + 6: (s6_addr32 : array[0..3] of LongInt); + end; + {$endif} + {$endif} + + tbinip=record + family:integer; + {$ifdef ipv6} + case integer of + 0: (ip:longint); + 1: (ip6:tin6_addr); + {$else} + ip:longint; + {$endif} + end; + + {$ifdef win32} + TInetSockAddr = packed Record + family:Word; + port :Word; + addr :uint32; + pad :array [1..8] of byte; + end; + {$ifdef ipv6} + + TInetSockAddr6 = packed record + sin6_family: word; + sin6_port: word; + sin6_flowinfo: uint32; + sin6_addr: tin6_addr; + sin6_scope_id: uint32; + end; + {$endif} + {$endif} + +function htons(w:word):word; +function htonl(i:uint32):uint32; + +function ipstrtobin(const s:string;var binip:tbinip):boolean; +function ipbintostr(const binip:tbinip):string; +{$ifdef ipv6} +function ip6bintostr(const bin:tin6_addr):string; +function ip6strtobin(const s:string;var bin:tin6_addr):boolean; +{$endif} + +function comparebinip(const ip1,ip2:tbinip):boolean; + +{deprecated} +function longip(s:string):longint; + +procedure converttov4(var ip:tbinip); + +implementation + +uses sysutils; + +function htons(w:word):word; +begin + {$ifdef ENDIAN_LITTLE} + result := ((w and $ff00) shr 8) or ((w and $ff) shl 8); + {$else} + result := w; + {$endif} +end; + +function htonl(i:uint32):uint32; +begin + {$ifdef ENDIAN_LITTLE} + result := (i shr 24) or (i shr 8 and $ff00) or (i shl 8 and $ff0000) or (i shl 24 and $ff000000); + {$else} + result := i; + {$endif} +end; + +{internal} +{converts dotted v4 IP to longint. returns host endian order} +function longip(s:string):longint; +var + l:longint; + a,b:integer; +function convertbyte(const s:string):integer; +begin + result := strtointdef(s,-1); + if result < 0 then begin + result := -1; + exit; + end; + if result > 255 then begin + result := -1; + exit; + end; + {01 exception} + if (result <> 0) and (s[1] = '0') then begin + result := -1; + exit; + end; + {+1 exception} + if not (s[1] in ['0'..'9']) then begin + result := -1; + exit + end; +end; + +begin + result := 0; + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := b shl 24; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 16; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 8; + s := copy(s,a+1,256); + b := convertbyte(copy(s,1,256));if (b < 0) then exit; + l := l or b; + result := l; +end; + + +function ipstrtobin(const s:string;var binip:tbinip):boolean; +begin + binip.family := 0; + result := false; + {$ifdef ipv6} + if pos(':',s) <> 0 then begin + {try ipv6. use builtin routine} + result := ip6strtobin(s,binip.ip6); + if result then binip.family := AF_INET6; + exit; + end; + {$endif} + + {try v4} + binip.ip := htonl(longip(s)); + if (binip.ip <> 0) or (s = '0.0.0.0') then begin + result := true; + binip.family := AF_INET; + exit; + end; +end; + +function ipbintostr(const binip:tbinip):string; +var + a:integer; +begin + result := ''; + {$ifdef ipv6} + if binip.family = AF_INET6 then begin + result := ip6bintostr(binip.ip6); + end else + {$endif} + if binip.family = AF_INET then begin + a := htonl(binip.ip); + result := inttostr(a shr 24)+'.'+inttostr((a shr 16) and $ff)+'.'+inttostr((a shr 8) and $ff)+'.'+inttostr(a and $ff); + end; +end; + + +{------------------------------------------------------------------------------} + +{$ifdef ipv6} + +{ +IPv6 address binary to/from string conversion routines +written by beware (steendijk at xs4all dot nl) + +- implementation does not depend on other ipv6 code such as the tin6_addr type, + the parameter can also be untyped. +- it is host endian neutral - binary format is aways network order +- it supports compression of zeroes +- it supports ::ffff:192.168.12.34 style addresses +- they are made to do the Right Thing, more efficient implementations are possible +} + +{fpc has hostaddrtostr6 and strtohostaddr6 but the later isnt implemented yet} + + +function ip6bintostr(const bin:tin6_addr):string; +{base16 with lowercase output} +function makehex(w:word):string; +begin + result := ''; + if w >= 4096 then result := result + hexchars[w shr 12]; + if w >= 256 then result := result + hexchars[w shr 8 and $f]; + if w >= 16 then result := result + hexchars[w shr 4 and $f]; + result := result + hexchars[w and $f]; +end; + +var + a,b,c,addrlen:integer; + runbegin,runlength:integer; + bytes:array[0..15] of byte absolute bin; + words:array[0..7] of word; + dwords:array[0..3] of integer absolute words; +begin + for a := 0 to 7 do begin + words[a] := bytes[a shl 1] shl 8 or bytes[a shl 1 or 1]; + end; + if (dwords[0] = 0) and (dwords[1] = 0) and (words[4] = 0) and (words[5] = $ffff) then begin + {::ffff:/96 exception: v4 IP} + addrlen := 6; + end else begin + addrlen := 8; + end; + {find longest run of zeroes} + runbegin := 0; + runlength := 0; + for a := 0 to addrlen-1 do begin + if words[a] = 0 then begin + c := 0; + for b := a to addrlen-1 do if words[b] = 0 then begin + inc(c); + end else break; + if (c > runlength) then begin + runlength := c; + runbegin := a; + end; + end; + end; + result := ''; + for a := 0 to runbegin-1 do begin + if (a <> 0) then result := result + ':'; + result := result + makehex(words[a]); + end; + if runlength > 0 then result := result + '::'; + c := runbegin+runlength; + for a := c to addrlen-1 do begin + if (a > c) then result := result + ':'; + result := result + makehex(words[a]); + end; + if addrlen = 6 then begin + result := result + ':'+inttostr(bytes[12])+'.'+inttostr(bytes[13])+'.'+inttostr(bytes[14])+'.'+inttostr(bytes[15]); + end; +end; + +function ip6strtobin(const s:string;var bin:tin6_addr):boolean; +var + a,b:integer; + fields:array[0..7] of string; + fieldcount:integer; + emptyfield:integer; + wordcount:integer; + words:array[0..7] of word; + bytes:array[0..15] of byte absolute bin; +begin + result := false; + for a := 0 to 7 do fields[a] := ''; + fieldcount := 0; + for a := 1 to length(s) do begin + if s[a] = ':' then inc(fieldcount) else fields[fieldcount] := fields[fieldcount] + s[a]; + if fieldcount > 7 then exit; + end; + if fieldcount < 2 then exit; + + {find the empty field (compressed zeroes), not counting the first and last there may be at most 1} + emptyfield := -1; + for a := 1 to fieldcount-1 do begin + if fields[a] = '' then begin + if emptyfield = -1 then emptyfield := a else exit; + end; + end; + + {check if last field is a valid v4 IP} + a := longip(fields[fieldcount]); + if (a <> 0) or (fields[fieldcount] = '0.0.0.0') then wordcount := 6 else wordcount := 8; + {0:1:2:3:4:5:6.6.6.6 + 0:1:2:3:4:5:6:7} + fillchar(words,sizeof(words),0); + if wordcount = 6 then begin + if fieldcount > 6 then exit; + words[6] := a shr 16; + words[7] := a and $ffff; + end; + if emptyfield = -1 then begin + {no run length: must be an exact number of fields} + if wordcount = 6 then begin + if fieldcount <> 6 then exit; + emptyfield := 5; + end else if wordcount = 8 then begin + if fieldcount <> 7 then exit; + emptyfield := 7; + end else exit; + end; + for a := 0 to emptyfield do begin + if fields[a] = '' then b := 0 else b := strtointdef('$'+fields[a],-1); + if (b < 0) or (b > $ffff) then exit; + words[a] := b; + end; + if wordcount = 6 then dec(fieldcount); + for a := wordcount-1 downto wordcount-(fieldcount-emptyfield) do begin + b := a+fieldcount-wordcount+1; + if fields[b] = '' then b := 0 else b := strtointdef('$'+fields[b],-1); + if (b < 0) or (b > $ffff) then exit; + words[a] := b; + end; + for a := 0 to 7 do begin + bytes[a shl 1] := words[a] shr 8; + bytes[a shl 1 or 1] := words[a] and $ff; + end; + result := true; +end; +{$endif} + +function comparebinip(const ip1,ip2:tbinip):boolean; +begin + if (ip1.ip <> ip2.ip) then begin + result := false; + exit; + end; + + {$ifdef ipv6} + if ip1.family = AF_INET6 then begin + if (ip1.ip6.s6_addr32[1] <> ip2.ip6.s6_addr32[1]) + or (ip1.ip6.s6_addr32[2] <> ip2.ip6.s6_addr32[2]) + or (ip1.ip6.s6_addr32[3] <> ip2.ip6.s6_addr32[3]) then begin + result := false; + exit; + end; + end; + {$endif} + + result := (ip1.family = ip2.family); +end; + +{converts a binary IP to v4 if it is a v6 IP in the v4 range} +procedure converttov4(var ip:tbinip); +begin + {$ifdef ipv6} + if ip.family = AF_INET6 then begin + if (ip.ip6.u6_addr32[0] = 0) and (ip.ip6.u6_addr32[1] = 0) and + (ip.ip6.u6_addr16[4] = 0) and (ip.ip6.u6_addr16[5] = $ffff) then begin + ip.family := AF_INET; + ip.ip := ip.ip6.s6_addr32[3]; + end; + end; + {$endif} +end; + +end. diff --git a/blinklist.pas b/blinklist.pas new file mode 100755 index 0000000..2079b75 --- /dev/null +++ b/blinklist.pas @@ -0,0 +1,118 @@ +(* + * beware IRC services, blinklist.pas + * Copyright (C) 2002 Bas Steendijk + * + * This program is free software; you can redistribute it and/or modify + * it under the terms of the GNU General Public License as published by + * the Free Software Foundation; either version 2 of the License, or + * (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with this program; if not, write to the Free Software + * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + *) +unit blinklist; +{$ifdef fpc} + {$mode delphi} +{$endif} + + +interface + +type + tlinklist=class(tobject) + next:tlinklist; + prev:tlinklist; + constructor create; + destructor destroy; override; + end; + + {linklist with 2 links} + tlinklist2=class(tlinklist) + next2:tlinklist2; + prev2:tlinklist2; + end; + + {linklist with one pointer} + tplinklist=class(tlinklist) + p:pointer + end; + + tstringlinklist=class(tlinklist) + s:string; + end; + + tthing=class(tlinklist) + name:string; {name/nick} + hashname:integer; {hash of name} + end; + +{ +adding new block to list (baseptr) +} +procedure linklistadd(var baseptr:tlinklist;newptr:tlinklist); +procedure linklistdel(var baseptr:tlinklist;item:tlinklist); + + +procedure linklist2add(var baseptr,newptr:tlinklist2); +procedure linklist2del(var baseptr:tlinklist2;item:tlinklist2); + +var + linklistdebug:integer; + +implementation + +procedure linklistadd(var baseptr:tlinklist;newptr:tlinklist); +var + p:tlinklist; +begin + p := baseptr; + baseptr := newptr; + baseptr.prev := nil; + baseptr.next := p; + if p <> nil then p.prev := baseptr; +end; + +procedure linklistdel(var baseptr:tlinklist;item:tlinklist); +begin + if item = baseptr then baseptr := item.next; + if item.prev <> nil then item.prev.next := item.next; + if item.next <> nil then item.next.prev := item.prev; +end; + +procedure linklist2add(var baseptr,newptr:tlinklist2); +var + p:tlinklist2; +begin + p := baseptr; + baseptr := newptr; + baseptr.prev2 := nil; + baseptr.next2 := p; + if p <> nil then p.prev2 := baseptr; +end; + +procedure linklist2del(var baseptr:tlinklist2;item:tlinklist2); +begin + if item = baseptr then baseptr := item.next2; + if item.prev2 <> nil then item.prev2.next2 := item.next2; + if item.next2 <> nil then item.next2.prev2 := item.prev2; +end; + +constructor tlinklist.create; +begin + inherited create; + inc(linklistdebug); +end; + +destructor tlinklist.destroy; +begin + dec(linklistdebug); + inherited destroy; +end; + +end. diff --git a/bsearchtree.pas b/bsearchtree.pas new file mode 100755 index 0000000..ad61751 --- /dev/null +++ b/bsearchtree.pas @@ -0,0 +1,101 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{actually a hashtable. it was a tree in earlier versions} + +unit bsearchtree; + +interface + +uses blinklist; + +const + hashtable_size=$4000; + +type + thashitem=class(tlinklist) + hash:integer; + s:string; + p:pointer; + end; + thashtable=array[0..hashtable_size-1] of thashitem; + phashtable=^thashtable; + +{adds "item" to the tree for name "s". the name must not exist (no checking done)} +procedure addtree(t:phashtable;s:string;item:pointer); + +{removes name "s" from the tree. the name must exist (no checking done)} +procedure deltree(t:phashtable;s:string); + +{returns the item pointer for s, or nil if not found} +function findtree(t:phashtable;s:string):pointer; + +implementation + +function makehash(s:string):integer; +const + shifter=6; +var + a,b:integer; +begin + result := 0; + b := length(s); + for a := 1 to b do begin + result := (result shl shifter) xor byte(s[a]); + end; + result := (result xor result shr 16) and (hashtable_size-1); +end; + +procedure addtree(t:phashtable;s:string;item:pointer); +var + hash:integer; + p:thashitem; +begin + hash := makehash(s); + p := thashitem.create; + p.hash := hash; + p.s := s; + p.p := item; + linklistadd(tlinklist(t[hash]),tlinklist(p)); +end; + +procedure deltree(t:phashtable;s:string); +var + p,p2:thashitem; + hash:integer; +begin + hash := makehash(s); + p := t[hash]; + p2 := nil; + while p <> nil do begin + if p.s = s then begin + p2 := p; + break; + end; + p := thashitem(p.next); + end; + linklistdel(tlinklist(t[hash]),tlinklist(p2)); + p2.destroy; +end; + + +function findtree(t:phashtable;s:string):pointer; +var + p:thashitem; + hash:integer; +begin + result := nil; + hash := makehash(s); + p := t[hash]; + while p <> nil do begin + if p.s = s then begin + result := p.p; + exit; + end; + p := thashitem(p.next); + end; +end; + +end. diff --git a/btime.pas b/btime.pas new file mode 100755 index 0000000..3d672c4 --- /dev/null +++ b/btime.pas @@ -0,0 +1,362 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +{ +this unit returns unix timestamp with seconds and microseconds (as float) +works on windows/delphi, and on freepascal on unix. +} + +unit btime; + +interface + +type + float=extended; + +var + timezone:integer; + timezonestr:string; + irctime,unixtime:integer; + tickcount:integer; + settimebias:integer; + qpcjump:float; {can be read out and reset for debug purpose} + performancecountfreq:extended; + +function irctimefloat:float; +function irctimeint:integer; + +function unixtimefloat:float; +function unixtimeint:integer; + +function wintimefloat:float; + +procedure settime(newtime:integer); +procedure gettimezone; +procedure timehandler; +procedure init; + +function timestring(i:integer):string; +function timestrshort(i:integer):string; + +function oletounixfloat(t:float):float; +function oletounix(t:tdatetime):integer; +function unixtoole(i:integer):tdatetime; + +var + timefloatbias:float; + lastunixtimefloat:float=0; + +implementation + +{$ifdef fpc} + {$mode delphi} +{$endif} + +uses + {$ifdef UNIX} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil,{needed for 2.0.2} + {$endif} + {$else} + windows, + {$endif} + sysutils; + + {$include unixstuff.inc} + + +const + daysdifference=25569; + +function oletounixfloat(t:float):float; +begin + t := (t - daysdifference) * 86400; + result := t; +end; + +function oletounix(t:tdatetime):integer; +begin + result := trunc(oletounixfloat(t)); +end; + +function unixtoole(i:integer):tdatetime; +begin + result := ((i)/86400)+daysdifference; +end; + +{$ifdef unix} +{-----------------------------------------*nix/freepascal code to read time } + +function unixtimefloat:float; +var + tv:ttimeval; +begin + gettimeofday(tv); + result := tv.tv_sec+(tv.tv_usec/1000000); +end; + +function wintimefloat:extended; +begin + result := unixtimefloat; +end; + +function unixtimeint:integer; +var + tv:ttimeval; +begin + gettimeofday(tv); + result := tv.tv_sec; +end; + +{$else} {delphi 3} +{------------------------------ windows/delphi code to read time} + +{ free pascals tsystemtime is incomaptible with windows api calls + so we declare it ourselves - plugwash +} +{$ifdef fpc} +type + TSystemTime = record + wYear: Word; + wMonth: Word; + wDayOfWeek: Word; + wDay: Word; + wHour: Word; + wMinute: Word; + wSecond: Word; + wMilliseconds: Word; + end; + {$endif} +function Date_utc: extended; +var + SystemTime: TSystemTime; +begin + {$ifdef fpc} + GetsystemTime(@SystemTime); + {$else} + GetsystemTime(SystemTime); + {$endif} + with SystemTime do Result := EncodeDate(wYear, wMonth, wDay); +end; + +function Time_utc: extended; +var + SystemTime: TSystemTime; +begin + {$ifdef fpc} + GetsystemTime(@SystemTime); + {$else} + GetsystemTime(SystemTime); + {$endif} + with SystemTime do + Result := EncodeTime(wHour, wMinute, wSecond, wMilliSeconds); +end; + +function Now_utc: extended; +begin + Result := round(Date_utc) + Time_utc; +end; + +const + highdwordconst=4294967296.0; + +function wintimefloat:extended; +var + p:packed record + lowpart:longint; + highpart:longint + end; + p2:tlargeinteger absolute p; + e:extended; +begin + if performancecountfreq = 0 then begin + QueryPerformancefrequency(p2); + e := p.lowpart; + if e < 0 then e := e + highdwordconst; + performancecountfreq := ((p.highpart*highdwordconst)+e); + end; + queryperformancecounter(p2); + e := p.lowpart; + if e < 0 then e := e + highdwordconst; + result := ((p.highpart*highdwordconst)+e)/performancecountfreq; +end; + +var + classpriority,threadpriority:integer; + +procedure settc; +var + hprocess,hthread:integer; +begin + hProcess := GetCurrentProcess; + hThread := GetCurrentThread; + + ClassPriority := GetPriorityClass(hProcess); + ThreadPriority := GetThreadPriority(hThread); + + SetPriorityClass(hProcess, REALTIME_PRIORITY_CLASS); + SetThreadPriority(hThread, THREAD_PRIORITY_TIME_CRITICAL); +end; + +procedure unsettc; +var + hprocess,hthread:integer; +begin + hProcess := GetCurrentProcess; + hThread := GetCurrentThread; + + SetPriorityClass(hProcess, ClassPriority); + SetThreadPriority(hThread, ThreadPriority); +end; + +function unixtimefloat:float; +var + f,g,h:float; +begin + if timefloatbias = 0 then begin + settc; + f := now_utc; + repeat g := now_utc; h := wintimefloat until g > f; + timefloatbias := oletounixfloat(g)-h; + unsettc; + end; + result := wintimefloat+timefloatbias; + + { + workaround for QPC jumps + (approach 2: always check "hi res" QPC unixtime against the "guaranteed" systemtime one) + } + f := result-(oletounixfloat(now_utc)); + if abs(f) > 0.02 then begin + f := timefloatbias; + timefloatbias := 0; + result := unixtimefloat; + qpcjump := qpcjump + f - timefloatbias; + end; + + if (result <= lastunixtimefloat) then result := lastunixtimefloat + 0.0000001; + lastunixtimefloat := result; +end; + +function unixtimeint:integer; +begin + result := trunc(unixtimefloat); +end; + +{$endif} +{-----------------------------------------------end of platform specific} + +function irctimefloat:float; +begin + result := unixtimefloat+settimebias; +end; + +function irctimeint:integer; +begin + result := unixtimeint+settimebias; +end; + + +procedure settime(newtime:integer); +var + a:integer; +begin + a := irctimeint-settimebias; + if newtime = 0 then settimebias := 0 else settimebias := newtime-a; + + irctime := irctimeint; +end; + +procedure timehandler; +begin + if unixtime = 0 then init; + unixtime := unixtimeint; + irctime := irctimeint; + if unixtime and 63 = 0 then begin + {update everything, apply timezone changes, clock changes, etc} + gettimezone; + timefloatbias := 0; + unixtime := unixtimeint; + irctime := irctimeint; + end; +end; + + +procedure gettimezone; +var + {$ifdef UNIX} + {$ifndef ver1_9_4} + {$ifndef ver1_0} + {$define above194} + {$endif} + {$endif} + {$ifndef above194} + hh,mm,ss:word; + {$endif} + {$endif} + l:integer; +begin + {$ifdef UNIX} + {$ifdef above194} + timezone := tzseconds; + {$else} + gettime(hh,mm,ss); + timezone := (longint(hh) * 3600 + mm * 60 + ss) - (unixtimeint mod 86400); + {$endif} + {$else} + timezone := round((now-now_utc)*86400); + {$endif} + + while timezone > 43200 do dec(timezone,86400); + while timezone < -43200 do inc(timezone,86400); + + if timezone >= 0 then timezonestr := '+' else timezonestr := '-'; + l := abs(timezone) div 60; + timezonestr := timezonestr + char(l div 600 mod 10+48)+char(l div 60 mod 10+48)+':'+char(l div 10 mod 6+48)+char(l mod 10+48); +end; + +function timestrshort(i:integer):string; +const + weekday:array[0..6] of string[4]=('Thu','Fri','Sat','Sun','Mon','Tue','Wed'); + month:array[0..11] of string[4]=('Jan','Feb','Mar','Apr','May','Jun','Jul','Aug','Sep','Oct','Nov','Dec'); +var + y,m,d,h,min,sec,ms:word; + t:tdatetime; +begin + t := unixtoole(i+timezone); + decodedate(t,y,m,d); + decodetime(t,h,min,sec,ms); + result := weekday[(i+timezone) div 86400 mod 7]+' '+month[m-1]+' '+inttostr(d)+' '+ + inttostr(h div 10)+inttostr(h mod 10)+':'+inttostr(min div 10)+inttostr(min mod 10)+':'+inttostr(sec div 10)+inttostr(sec mod 10)+' '+ + inttostr(y); +end; + +function timestring(i:integer):string; +const + weekday:array[0..6] of string[10]=('Thursday','Friday','Saturday','Sunday','Monday','Tuesday','Wednesday'); + month:array[0..11] of string[10]=('January','February','March','April','May','June','July','August','September','October','November','December'); +var + y,m,d,h,min,sec,ms:word; + t:tdatetime; +begin + t := unixtoole(i+timezone); + decodedate(t,y,m,d); + decodetime(t,h,min,sec,ms); + result := weekday[(i+timezone) div 86400 mod 7]+' '+month[m-1]+' '+inttostr(d)+' '+inttostr(y)+' -- '+ + inttostr(h div 10)+inttostr(h mod 10)+':'+inttostr(min div 10)+inttostr(min mod 10)+':'+inttostr(sec div 10)+inttostr(sec mod 10)+' '+ + timezonestr; +end; + +procedure init; +begin + qpcjump := 0; + settimebias := 0; + gettimezone; + unixtime := unixtimeint; + irctime := irctimeint; +end; + +end. diff --git a/dnsasync.pas b/dnsasync.pas new file mode 100755 index 0000000..0a32459 --- /dev/null +++ b/dnsasync.pas @@ -0,0 +1,247 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +//FIXME: this code only ever seems to use one dns server for a request and does +//not seem to have any form of retry code. + +unit dnsasync; + +interface + +uses + {$ifdef win32} + dnswin, + {$endif} + lsocket,lcore, + classes,binipstuff,dnscore,btime; + + +type + //after completion or cancelation a dnswinasync may be reused + tdnsasync=class(tcomponent) + + private + //made a load of stuff private that does not appear to be part of the main + //public interface. If you make any of it public again please consider the + //consequences when using windows dns. --plugwash. + sock:twsocket; + + sockopen:boolean; + + + state:tdnsstate; + + dnsserverid:integer; + startts:double; + {$ifdef win32} + dwas : tdnswinasync; + {$endif} + + + procedure asyncprocess; + procedure receivehandler(sender:tobject;error:word); + function sendquery(const packet:tdnspacket;len:integer):boolean; + {$ifdef win32} + procedure winrequestdone(sender:tobject;error:word); + {$endif} + public + onrequestdone:tsocketevent; + + //addr and port allow the application to specify a dns server specifically + //for this dnsasync object. This is not a reccomended mode of operation + //because it limits the app to one dns server but is kept for compatibility + //and special uses. + addr,port:string; + + //A family value of AF_INET6 will give only + //ipv6 results. Any other value will give ipv4 results in preference and ipv6 + //results if ipv4 results are not available; + forwardfamily:integer; + + procedure cancel;//cancel an outstanding dns request + function dnsresult:string; //get result of dnslookup as a string + procedure dnsresultbin(var binip:tbinip); //get result of dnslookup as a tbinip + procedure forwardlookup(const name:string); //start forward lookup, + //preffering ipv4 + procedure reverselookup(const binip:tbinip); //start reverse lookup + + constructor create(aowner:tcomponent); override; + destructor destroy; override; + + end; + +implementation + +uses sysutils; + +constructor tdnsasync.create; +begin + inherited create(aowner); + dnsserverid := -1; + sock := twsocket.create(self); +end; + +destructor tdnsasync.destroy; +begin + if dnsserverid >= 0 then begin + reportlag(dnsserverid,-1); + dnsserverid := -1; + end; + sock.release; + setstate_request_init('',state); + inherited destroy; +end; + +procedure tdnsasync.receivehandler; +begin + if dnsserverid >= 0 then begin + reportlag(dnsserverid,trunc((unixtimefloat-startts)*1000)); + dnsserverid := -1; + end; +{ writeln('received reply');} + fillchar(state.recvpacket,sizeof(state.recvpacket),0); + state.recvpacketlen := twsocket(sender).Receive(@state.recvpacket, SizeOf(state.recvpacket)); + state.parsepacket := true; + asyncprocess; +end; + +function tdnsasync.sendquery; +begin +{ writeln('sendquery ',decodename(state.packet,state.packetlen,12,0,a),' ',state.requesttype);} + result := false; + if len = 0 then exit; {no packet} + if not sockopen then begin + if addr <> '' then sock.addr := addr else sock.addr := getcurrentsystemnameserver(dnsserverid);//getunixnameservercached; + startts := unixtimefloat; + if port = '' then port := '53'; + sock.port := port; + sock.Proto := 'udp'; + sock.ondataavailable := receivehandler; + try + sock.connect; + except + on e:exception do begin + //writeln('exception '+e.message); + exit; + end; + end; + sockopen := true; + end; + sock.send(@packet,len); + result := true; +end; + +procedure tdnsasync.asyncprocess; +begin + state_process(state); + case state.resultaction of + action_ignore: begin {do nothing} end; + action_done: begin + onrequestdone(self,0); + end; + action_sendquery:begin + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; +end; + +procedure tdnsasync.forwardlookup; +begin + + ipstrtobin(name,state.resultbin); + + {$ifdef win32} + if usewindns or (addr = '') then begin + dwas := tdnswinasync.create; + dwas.onrequestdone := winrequestdone; + if forwardfamily = AF_INET6 then begin + dwas.forwardlookup(name,true); + end else begin + dwas.forwardlookup(name,false); + end; + exit; + end; + {$endif} + + + if state.resultbin.family <> 0 then begin + onrequestdone(self,0); + exit; + end; + + + setstate_forward(name,state,forwardfamily); + asyncprocess; + +end; + +procedure tdnsasync.reverselookup; + +begin + {$ifdef win32} + if usewindns or (addr = '') then begin + dwas := tdnswinasync.create; + dwas.onrequestdone := winrequestdone; + dwas.reverselookup(binip); + exit; + end; + {$endif} + + setstate_reverse(binip,state); + asyncprocess; +end; + +function tdnsasync.dnsresult; +begin + if state.resultstr <> '' then result := state.resultstr else begin + result := ipbintostr(state.resultbin); + end; +end; + +procedure tdnsasync.dnsresultbin(var binip:tbinip); +begin + move(state.resultbin,binip,sizeof(binip)); +end; + +procedure tdnsasync.cancel; +begin + {$ifdef win32} + if assigned(dwas) then begin + dwas.release; + dwas := nil; + end else + {$endif} + begin + + if dnsserverid >= 0 then begin + reportlag(dnsserverid,-1); + dnsserverid := -1; + end; + if sockopen then begin + sock.close; + sockopen := false; + end; + end; + setstate_failure(state); + onrequestdone(self,0); +end; + +{$ifdef win32} + procedure tdnsasync.winrequestdone(sender:tobject;error:word); + + begin + if dwas.reverse then begin + state.resultstr := dwas.name; + end else begin + state.resultbin := dwas.ip; + if (forwardfamily = AF_INET6) and (state.resultbin.family = AF_INET) then begin + fillchar(state.resultbin,sizeof(tbinip),0); + end; + end; + dwas.release; + onrequestdone(self,error); + end; +{$endif} +end. diff --git a/dnscore.pas b/dnscore.pas new file mode 100755 index 0000000..bb4fab4 --- /dev/null +++ b/dnscore.pas @@ -0,0 +1,728 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{ + + code wanting to use this dns system should act as follows (note: app + developers will probablly want to use dnsasync or dnssync or write a similar + wrapper unit of thier own). + + for normal lookups call setstate_forward or setstate_reverse to set up the + state, for more obscure lookups use setstate_request_init and fill in other + relavent state manually. + + call state_process which will do processing on the information in the state + and return an action + action_ignore means that dnscore wants the code that calls it to go + back to waiting for packets + action_sendpacket means that dnscore wants the code that calls it to send + the packet in sendpacket/sendpacketlen and then start (or go back to) listening + for + action_done means the request has completed (either suceeded or failed) + + callers should resend the last packet they tried to send if they have not + been asked to send a new packet for more than some timeout value they choose. + + when a packet is received the application should put the packet in + recvbuf/recvbuflen , set state.parsepacket and call state_process again + + once the app gets action_done it can determine sucess or failure in the + following ways. + + on failure state.resultstr will be an empty string and state.resultbin will + be zeroed out (easilly detected by the fact that it will have a family of 0) + + on success for a A or AAAA lookup state.resultstr will be an empty string + and state.resultbin will contain the result (note: AAAA lookups require IPV6 + enabled). + + if an A lookup fails and the code is built with ipv6 enabled then the code + will return any AAAA records with the same name. The reverse does not apply + so if an application preffers IPV6 but wants IPV4 results as well it must + check them seperately. + + on success for any other type of lookup state.resultstr will be an empty + + note the state contains ansistrings, setstate_init with a null name parameter + can be used to clean theese up if required. + + callers may use setstate_failure to mark the state as failed themseleves + before passing it on to other code, for example this may be done in the event + of a timeout. +} +unit dnscore; + + + +{$ifdef fpc}{$mode delphi}{$endif} + + + + + +interface + +uses binipstuff,classes,pgtypes; + +var usewindns : boolean = {$ifdef win32}true{$else}false{$endif}; +//hint to users of this unit that they should use windows dns instead. +//May be disabled by applications if desired. (e.g. if setting a custom +//dnsserverlist). + +//note: this unit will not be able to self populate it's dns server list on +//older versions of windows. + +const + maxnamelength=127; + maxnamefieldlen=63; + //note: when using action_ignore the dnscore code *must* preserve the contents of state.sendpacket to allow for retries + //note: action_ignore must not be used in response to the original request but there is no valid reason for doing this anyway + action_ignore=0; + action_done=1; + action_sendquery=2; + querytype_a=1; + querytype_cname=5; + querytype_aaaa=28; + querytype_ptr=12; + querytype_ns=2; + querytype_soa=6; + querytype_mx=15; + + maxrecursion=10; + maxrrofakind=20; + + retryafter=300000; //microseconds must be less than one second; + timeoutlag=1000000000; // penalty value to be treated as lag in the event of a timeout (microseconds) +type + dvar=array[0..0] of byte; + pdvar=^dvar; + tdnspacket=packed record + id:word; + flags:word; + rrcount:array[0..3] of word; + payload:array[0..511-12] of byte; + end; + + + + tdnsstate=record + id:word; + recursioncount:integer; + queryname:string; + requesttype:word; + parsepacket:boolean; + resultstr:string; + resultbin:tbinip; + resultaction:integer; + numrr1:array[0..3] of integer; + numrr2:integer; + rrdata:string; + sendpacketlen:integer; + sendpacket:tdnspacket; + recvpacketlen:integer; + recvpacket:tdnspacket; + forwardfamily:integer; + end; + + trr=packed record + requesttypehi:byte; + requesttype:byte; + clas:word; + ttl:integer; + datalen:word; + data:array[0..511] of byte; + end; + + trrpointer=packed record + p:pointer; + ofs:integer; + len:integer; + namelen:integer; + end; + +//commenting out functions from interface that do not have documented semantics +//and probablly should not be called from outside this unit, reenable them +//if you must but please document them at the same time --plugwash + +//function buildrequest(const name:string;var packet:tdnspacket;requesttype:word):integer; +//function makereversename(const binip:tbinip):string; + +procedure setstate_request_init(const name:string;var state:tdnsstate); + +//set up state for a foward lookup. A family value of AF_INET6 will give only +//ipv6 results. Any other value will give ipv4 results in preference and ipv6 +//results if ipv4 results are not available; +procedure setstate_forward(const name:string;var state:tdnsstate;family:integer); + +procedure setstate_reverse(const binip:tbinip;var state:tdnsstate); +procedure setstate_failure(var state:tdnsstate); +//procedure setstate_return(const rrp:trrpointer;len:integer;var state:tdnsstate); + + +procedure state_process(var state:tdnsstate); + +//function decodename(const packet:tdnspacket;len,start,recursion:integer;var numread:integer):string; + +//presumablly this is exported to allow more secure random functions +//to be substituted? +var randomfunction:function:integer; + + +procedure populatednsserverlist; +procedure cleardnsservercache; + +var + dnsserverlist : tstringlist; +// currentdnsserverno : integer; + +function getcurrentsystemnameserver(var id:integer) :string; + +//var +// unixnameservercache:string; +{ $endif} + + +procedure reportlag(id:integer;lag:integer); //lag should be in microseconds and should be -1 to report a timeout +var + failurereason:string; + +implementation + +uses + {$ifdef win32} + windows, + {$endif} + + sysutils; + +function buildrequest(const name:string;var packet:tdnspacket;requesttype:word):integer; +var + a,b:integer; + s:string; + arr:array[0..sizeof(packet)-1] of byte absolute packet; +begin + { writeln('buildrequest: name: ',name);} + result := 0; + fillchar(packet,sizeof(packet),0); + if assigned(randomfunction) then packet.id := (randomfunction and $ffff) else packet.id := random(65536); + packet.flags := htons($0100); + packet.rrcount[0] := htons($0001); + + + s := copy(name,1,maxnamelength); + if s = '' then exit; + if s[length(s)] <> '.' then s := s + '.'; + b := 0; + {encode name} + if (s = '.') then begin + packet.payload[0] := 0; + result := 12+5; + end else begin + for a := 1 to length(s) do begin + if s[a] = '.' then begin + if b > maxnamefieldlen then exit; + if (b = 0) then exit; + packet.payload[a-b-1] := b; + b := 0; + end else begin + packet.payload[a] := byte(s[a]); + inc(b); + end; + end; + if b > maxnamefieldlen then exit; + packet.payload[length(s)-b] := b; + result := length(s) + 12+5; + end; + + arr[result-1] := 1; + arr[result-3] := requesttype and $ff; + arr[result-4] := requesttype shr 8; +end; + +function makereversename(const binip:tbinip):string; +var + name:string; + a,b:integer; +begin + name := ''; + if binip.family = AF_INET then begin + b := htonl(binip.ip); + for a := 0 to 3 do begin + name := name + inttostr(b shr (a shl 3) and $ff)+'.'; + end; + name := name + 'in-addr.arpa'; + end else + {$ifdef ipv6} + if binip.family = AF_INET6 then begin + for a := 15 downto 0 do begin + b := binip.ip6.u6_addr8[a]; + name := name + hexchars[b and $f]+'.'+hexchars[b shr 4]+'.'; + end; + name := name + 'ip6.arpa'; + end else + {$endif} + begin + {empty name} + end; + result := name; +end; + +{ +decodes DNS format name to a string. does not includes the root dot. +doesnt read beyond len. +empty result + non null failurereason: failure +empty result + null failurereason: internal use +} +function decodename(const packet:tdnspacket;len,start,recursion:integer;var numread:integer):string; +var + arr:array[0..sizeof(packet)-1] of byte absolute packet; + s:string; + a,b:integer; +begin + numread := 0; + repeat + if (start+numread < 0) or (start+numread >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range1'; + exit; + end; + b := arr[start+numread]; + if b >= $c0 then begin + {recursive sub call} + if recursion > 10 then begin + result := ''; + failurereason := 'decoding name: max recursion'; + exit; + end; + if ((start+numread+1) >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range3'; + exit; + end; + a := ((b shl 8) or arr[start+numread+1]) and $3fff; + s := decodename(packet,len,a,recursion+1,a); + if (s = '') and (failurereason <> '') then begin + result := ''; + exit; + end; + if result <> '' then result := result + '.'; + result := result + s; + inc(numread,2); + exit; + end else if b < 64 then begin + if (numread <> 0) and (b <> 0) then result := result + '.'; + for a := start+numread+1 to start+numread+b do begin + if (a >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range2'; + exit; + end; + result := result + char(arr[a]); + end; + inc(numread,b+1); + + if b = 0 then begin + if (result = '') and (recursion = 0) then result := '.'; + exit; {reached end of name} + end; + end else begin + failurereason := 'decoding name: read invalid char'; + result := ''; + exit; {invalid} + end; + until false; +end; + +{==============================================================================} + +procedure setstate_return(const rrp:trrpointer;len:integer;var state:tdnsstate); +var + a:integer; +begin + state.resultaction := action_done; + state.resultstr := ''; + case trr(rrp.p^).requesttype of + querytype_a: begin + if htons(trr(rrp.p^).datalen) <> 4 then exit; + move(trr(rrp.p^).data,state.resultbin.ip,4); + state.resultbin.family :=AF_INET; + end; + {$ifdef ipv6} + querytype_aaaa: begin + if htons(trr(rrp.p^).datalen) <> 16 then exit; + state.resultbin.family := AF_INET6; + move(trr(rrp.p^).data,state.resultbin.ip6,16); + end; + {$endif} + else + {other reply types (PTR, MX) return a hostname} + state.resultstr := decodename(state.recvpacket,state.recvpacketlen,taddrint(rrp.p)-taddrint(@state.recvpacket)+10,0,a); + fillchar(state.resultbin,sizeof(state.resultbin),0); + end; +end; + +procedure setstate_request_init(const name:string;var state:tdnsstate); +begin + {destroy things properly} + state.resultstr := ''; + state.queryname := ''; + state.rrdata := ''; + fillchar(state,sizeof(state),0); + state.queryname := name; + state.parsepacket := false; +end; + +procedure setstate_forward(const name:string;var state:tdnsstate;family:integer); +begin + setstate_request_init(name,state); + state.forwardfamily := family; + {$ifdef ipv6} + if family = AF_INET6 then state.requesttype := querytype_aaaa else + {$endif} + state.requesttype := querytype_a; +end; + +procedure setstate_reverse(const binip:tbinip;var state:tdnsstate); +begin + setstate_request_init(makereversename(binip),state); + state.requesttype := querytype_ptr; +end; + +procedure setstate_failure(var state:tdnsstate); +begin + state.resultstr := ''; + fillchar(state.resultbin,sizeof(state.resultbin),0); + state.resultaction := action_done; +end; + +procedure state_process(var state:tdnsstate); +label recursed; +label failure; +var + a,b,ofs:integer; + rrtemp:^trr; + rrptemp:^trrpointer; +begin + if state.parsepacket then begin + if state.recvpacketlen < 12 then begin + failurereason := 'Undersized packet'; + state.resultaction := action_ignore; + exit; + end; + if state.id <> state.recvpacket.id then begin + failurereason := 'ID mismatch'; + state.resultaction := action_ignore; + exit; + end; + state.numrr2 := 0; + for a := 0 to 3 do begin + state.numrr1[a] := htons(state.recvpacket.rrcount[a]); + if state.numrr1[a] > maxrrofakind then goto failure; + inc(state.numrr2,state.numrr1[a]); + end; + + setlength(state.rrdata,state.numrr2*sizeof(trrpointer)); + + {- put all replies into a list} + + ofs := 12; + {get all queries} + for a := 0 to state.numrr1[0]-1 do begin + if (ofs < 12) or (ofs > state.recvpacketlen-4) then goto failure; + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrptemp.p := @state.recvpacket.payload[ofs-12]; + rrptemp.ofs := ofs; + decodename(state.recvpacket,state.recvpacketlen,ofs,0,b); + rrptemp.len := b + 4; + inc(ofs,rrptemp.len); + end; + + for a := state.numrr1[0] to state.numrr2-1 do begin + if (ofs < 12) or (ofs > state.recvpacketlen-12) then goto failure; + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + if decodename(state.recvpacket,state.recvpacketlen,ofs,0,b) = '' then goto failure; + rrtemp := @state.recvpacket.payload[ofs-12+b]; {rrtemp points to values and result, after initial name} + rrptemp.p := rrtemp; + rrptemp.ofs := ofs; {ofs is start of RR before initial name from start of packet} + rrptemp.namelen := b; + b := htons(rrtemp.datalen); + rrptemp.len := b + 10 + rrptemp.namelen; + inc(ofs,rrptemp.len); + end; + if (ofs <> state.recvpacketlen) then begin + failurereason := 'ofs <> state.packetlen'; + goto failure; + end; + + {- check for items of the requested type in answer section, if so return success first} + for a := state.numrr1[0] to (state.numrr1[0]+state.numrr1[1]-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = state.requesttype then begin + setstate_return(rrptemp^,b,state); + exit; + end; + end; + + {if no items of correct type found, follow first cname in answer section} + for a := state.numrr1[0] to (state.numrr1[0]+state.numrr1[1]-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = querytype_cname then begin + state.queryname := decodename(state.recvpacket,state.recvpacketlen,rrptemp.ofs+12,0,b); + goto recursed; + end; + end; + + {no cnames found, no items of correct type found} + if state.forwardfamily <> 0 then goto failure; +{$ifdef ipv6} + if (state.requesttype = querytype_a) then begin + {v6 only: in case of forward, look for AAAA in alternative section} + for a := state.numrr1[0]+state.numrr1[1]+state.numrr1[2] to (state.numrr2-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = querytype_aaaa then begin + setstate_return(rrptemp^,b,state); + exit; + end; + end; + {no AAAA's found in alternative, do a recursive lookup for them} + state.requesttype := querytype_aaaa; + goto recursed; + end; +{$endif} + goto failure; +recursed: + {here it needs recursed lookup} + {if needing to follow a cname, change state to do so} + inc(state.recursioncount); + if state.recursioncount > maxrecursion then goto failure; + end; + + {here, a name needs to be resolved} + if state.queryname = '' then begin + failurereason := 'empty query name'; + goto failure; + end; + + {do /ets/hosts lookup here} + state.sendpacketlen := buildrequest(state.queryname,state.sendpacket,state.requesttype); + if state.sendpacketlen = 0 then begin + failurereason := 'building request packet failed'; + goto failure; + end; + state.id := state.sendpacket.id; + state.resultaction := action_sendquery; + + exit; +failure: + setstate_failure(state); +end; +{$ifdef win32} + const + MAX_HOSTNAME_LEN = 132; + MAX_DOMAIN_NAME_LEN = 132; + MAX_SCOPE_ID_LEN = 260 ; + MAX_ADAPTER_NAME_LENGTH = 260; + MAX_ADAPTER_ADDRESS_LENGTH = 8; + MAX_ADAPTER_DESCRIPTION_LENGTH = 132; + ERROR_BUFFER_OVERFLOW = 111; + MIB_IF_TYPE_ETHERNET = 6; + MIB_IF_TYPE_TOKENRING = 9; + MIB_IF_TYPE_FDDI = 15; + MIB_IF_TYPE_PPP = 23; + MIB_IF_TYPE_LOOPBACK = 24; + MIB_IF_TYPE_SLIP = 28; + + + type + tip_addr_string=packed record + Next :pointer; + IpAddress : array[0..15] of char; + ipmask : array[0..15] of char; + context : dword; + end; + pip_addr_string=^tip_addr_string; + tFIXED_INFO=packed record + HostName : array[0..MAX_HOSTNAME_LEN-1] of char; + DomainName : array[0..MAX_DOMAIN_NAME_LEN-1] of char; + currentdnsserver : pip_addr_string; + dnsserverlist : tip_addr_string; + nodetype : longint; + ScopeId : array[0..MAX_SCOPE_ID_LEN + 4] of char; + enablerouting : longbool; + enableproxy : longbool; + enabledns : longbool; + end; + pFIXED_INFO=^tFIXED_INFO; + + var + iphlpapi : thandle; + getnetworkparams : function(pFixedInfo : PFIXED_INFO;OutBufLen : plongint) : longint;stdcall; +{$endif} +procedure populatednsserverlist; +var + {$ifdef win32} + fixed_info : pfixed_info; + fixed_info_len : longint; + currentdnsserver : pip_addr_string; + {$else} + t:textfile; + s:string; + a:integer; + {$endif} +begin + //result := ''; + if assigned(dnsserverlist) then begin + dnsserverlist.clear; + end else begin + dnsserverlist := tstringlist.Create; + end; + {$ifdef win32} + if iphlpapi=0 then iphlpapi := loadlibrary('iphlpapi.dll'); + if not assigned(getnetworkparams) then @getnetworkparams := getprocaddress(iphlpapi,'GetNetworkParams'); + fixed_info_len := 0; + if GetNetworkParams(nil,@fixed_info_len)<>ERROR_BUFFER_OVERFLOW then exit; + //fixed_info_len :=sizeof(tfixed_info); + getmem(fixed_info,fixed_info_len); + if GetNetworkParams(fixed_info,@fixed_info_len)<>0 then begin + freemem(fixed_info); + exit; + end; + currentdnsserver := @(fixed_info.dnsserverlist); + while assigned(currentdnsserver) do begin + dnsserverlist.Add(currentdnsserver.IpAddress); + currentdnsserver := currentdnsserver.next; + end; + freemem(fixed_info); + {$else} + filemode := 0; + assignfile(t,'/etc/resolv.conf'); + {$i-}reset(t);{$i+} + if ioresult <> 0 then exit; + + while not eof(t) do begin + readln(t,s); + if not (copy(s,1,10) = 'nameserver') then continue; + s := copy(s,11,500); + while s <> '' do begin + if (s[1] = #32) or (s[1] = #9) then s := copy(s,2,500) else break; + end; + a := pos(' ',s); + if a <> 0 then s := copy(s,1,a-1); + a := pos(#9,s); + if a <> 0 then s := copy(s,1,a-1); + //result := s; + //if result <> '' then break; + dnsserverlist.Add(s); + end; + close(t); + {$endif} +end; + +procedure cleardnsservercache; +begin + if assigned(dnsserverlist) then begin + dnsserverlist.destroy; + dnsserverlist := nil; + end; +end; + +function getcurrentsystemnameserver(var id:integer):string; +var + counter : integer; + +begin + if not assigned(dnsserverlist) then populatednsserverlist; + if dnsserverlist.count=0 then raise exception.create('no dns servers availible'); + id := 0; + if dnsserverlist.count >1 then begin + + for counter := 1 to dnsserverlist.count-1 do begin + if taddrint(dnsserverlist.objects[counter]) < taddrint(dnsserverlist.objects[id]) then id := counter; + end; + end; + result := dnsserverlist[id] +end; + +procedure reportlag(id:integer;lag:integer); //lag should be in microseconds and should be -1 to report a timeout +var + counter : integer; + temp : integer; +begin + if (id < 0) or (id >= dnsserverlist.count) then exit; + if lag = -1 then lag := timeoutlag; + for counter := 0 to dnsserverlist.count-1 do begin + temp := taddrint(dnsserverlist.objects[counter]) *15; + if counter=id then temp := temp + lag; + dnsserverlist.objects[counter] := tobject(temp div 16); + end; + +end; + +{ quick and dirty description of dns packet structure to aid writing and + understanding of parser code, refer to appropriate RFCs for proper specs +- all words are network order + +www.google.com A request: + +0, 2: random transaction ID +2, 2: flags: only the "recursion desired" bit set. (bit 8 of word) +4, 2: questions: 1 +6, 2: answer RR's: 0. +8, 2: authority RR's: 0. +10, 2: additional RR's: 0. +12, n: payload: + query: + #03 "www" #06 "google" #03 "com" #00 + size-4, 2: type: host address (1) + size-2, 2: class: inet (1) + +reply: + +0,2: random transaction ID +2,2: flags: set: response (bit 15), recursion desired (8), recursion available (7) +4,4: questions: 1 +6,4: answer RR's: 2 +8,4: authority RR's: 9 +10,4: additional RR's: 9 +12: payload: + query: + .... + answer: CNAME + 0,2 "c0 0c" "name: www.google.com" + 2,2 "00 05" "type: cname for an alias" + 4,2 "00 01" "class: inet" + 6,4: TTL + 10,2: data length "00 17" (23) + 12: the cname name (www.google.akadns.net) + answer: A + 0,2 .. + 2,2 "00 01" host address + 4,2 ... + 6,4 ... + 10,2: data length (4) + 12,4: binary IP + authority - 9 records + additional - 9 records + + + ipv6 AAAA reply: + 0,2: ... + 2,2: type: 001c + 4,2: class: inet (0001) + 6,2: TTL + 10,2: data size (16) + 12,16: binary IP + + ptr request: query type 000c + +name compression: word "cxxx" in the name, xxx points to offset in the packet} + +end. diff --git a/dnssync.pas b/dnssync.pas new file mode 100755 index 0000000..379aa05 --- /dev/null +++ b/dnssync.pas @@ -0,0 +1,262 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit dnssync; +{$ifdef fpc} + {$mode delphi} +{$endif} + +interface + uses + dnscore, + binipstuff, + {$ifdef win32} + winsock, + windows, + {$else} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, + {$endif} + sockets, + fd_utils, + {$endif} + sysutils; + +//convert a name to an IP +//IPV4 is preffered if availible, if not IPV6 will be returned (if ipv6 support +//compiled in) +//on error the binip will have a family of 0 (other fiels are also currently +//zeroed out but may be used for further error information in future) +//timeout is in seconds, it is ignored when using windows dns +function forwardlookup(name:string;timeout:integer):tbinip; + + +//convert an IP to a name, on error a null string will be returned, other +//details as above +function reverselookup(ip:tbinip;timeout:integer):string; + + +var + dnssyncserver:string; + id : integer; + {$ifdef win32} + sendquerytime : integer; + {$else} + sendquerytime : ttimeval; + {$endif} +implementation +{$ifdef win32} + uses dnswin; +{$endif} + +{$i unixstuff.inc} +{$i ltimevalstuff.inc} + +var + fd:integer; + state:tdnsstate; +{$ifdef win32} + const + winsocket = 'wsock32.dll'; + function sendto(s: TSocket; const Buf; len, flags: Integer; var addrto: TinetSockAddr; tolen: Integer): Integer; stdcall; external winsocket name 'sendto'; + function bind(s: TSocket; var addr: TinetSockAddr; namelen: Integer): Longbool; stdcall; external winsocket name 'bind'; + type + fdset=tfdset; +{$endif} + +function sendquery(const packet:tdnspacket;len:integer):boolean; +var + a:integer; + addr : string; + port : string; + inaddr : TInetSockAddr; + +begin +{ writeln('sendquery ',decodename(state.packet,state.packetlen,12,0,a),' ',state.requesttype);} + result := false; + if len = 0 then exit; {no packet} + + if dnssyncserver <> '' then addr := dnssyncserver else addr := getcurrentsystemnameserver(id); + port := '53'; + + inAddr.family:=AF_INET; + inAddr.port:=htons(strtointdef(port,0)); + inAddr.addr:=htonl(longip(addr)); + + sendto(fd,packet,len,0,inaddr,sizeof(inaddr)); + {$ifdef win32} + sendquerytime := GetTickCount and $3fff; + {$else} + gettimeofday(sendquerytime); + {$endif} + result := true; +end; + +procedure setupsocket; +var + inAddrtemp : TInetSockAddr; +begin + if fd > 0 then exit; + + fd := Socket(AF_INET,SOCK_DGRAM,0); + inAddrtemp.family:=AF_INET; + inAddrtemp.port:=0; + inAddrtemp.addr:=0;{htonl(longip('0.0.0.0'));} + If {$ifndef win32}Not{$endif} Bind(fd,inAddrtemp,SizeOf(inAddrtemp)) Then begin + {$ifdef win32} + raise Exception.create('unable to bind '+inttostr(WSAGetLastError)); + {$else} + raise Exception.create('unable to bind '+inttostr(socketError)); + {$endif} + end; +end; + +procedure resolveloop(timeout:integer); +var + selectresult : integer; + fds : fdset; + {$ifdef win32} + endtime : longint; + starttime : longint; + wrapmode : boolean; + currenttime : integer; + {$else} + endtime : ttimeval; + currenttime : ttimeval; + + {$endif} + lag : ttimeval; + currenttimeout : ttimeval; + selecttimeout : ttimeval; + + +begin + {$ifdef win32} + starttime := GetTickCount and $3fff; + endtime := starttime +(timeout*1000); + if (endtime and $4000)=0 then begin + wrapmode := false; + end else begin + wrapmode := true; + end; + endtime := endtime and $3fff; + {$else} + gettimeofday(endtime); + endtime.tv_sec := endtime.tv_sec + timeout; + {$endif} + + setupsocket; + repeat + state_process(state); + case state.resultaction of + action_ignore: begin +{ writeln('ignore');} + {do nothing} + end; + action_done: begin +{ writeln('done');} + exit; + //onrequestdone(self,0); + end; + action_sendquery:begin +{ writeln('send query');} + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; + {$ifdef win32} + currenttime := GetTickCount and $3fff; + msectotimeval(selecttimeout, (endtime-currenttime)and$3fff); + {$else} + gettimeofday(currenttime); + selecttimeout := endtime; + tv_substract(selecttimeout,currenttime); + {$endif} + fd_zero(fds); + fd_set(fd,fds); + if (selecttimeout.tv_sec > 0) or (selecttimeout.tv_usec > retryafter) then begin + selecttimeout.tv_sec := 0; + selecttimeout.tv_usec := retryafter; + end; + selectresult := select(fd+1,@fds,nil,nil,@selecttimeout); + if selectresult > 0 then begin +{ writeln('selectresult>0');} + //why the hell are we zeroing out the packet buffer before reading into it?! --plugwash + fillchar(state.recvpacket,sizeof(state.recvpacket),0); + {$ifdef win32} + msectotimeval(lag,(currenttime-sendquerytime)and$3fff); + {$else} + lag := currenttime; + tv_substract(lag,sendquerytime); + + {$endif} + + reportlag(id,(lag.tv_sec*1000000)+lag.tv_usec); + state.recvpacketlen := recv(fd,state.recvpacket, SizeOf(state.recvpacket),0); + state.parsepacket := true; + end; + if selectresult < 0 then exit; + if selectresult = 0 then begin + {$ifdef win32} + currenttime := GetTickCount; + {$else} + gettimeofday(currenttime); + {$endif} + reportlag(id,-1); + if {$ifdef win32}(currenttime >= endtime)and ((not wrapmode) or (currenttime < starttime)) {$else}tv_compare(currenttime,endtime){$endif} {currenttime >= endtime } then begin + exit; + end else begin + //resend + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; + until false; +end; + +function forwardlookup(name:string;timeout:integer):tbinip; +var + dummy : integer; +begin + ipstrtobin(name,result); + if result.family <> 0 then exit; //it was an IP address, no need for dns + //lookup + {$ifdef win32} + if usewindns then begin + result := winforwardlookup(name,false,dummy); + exit; + end; + {$endif} + setstate_forward(name,state,0); + resolveloop(timeout); + result := state.resultbin; +end; + +function reverselookup(ip:tbinip;timeout:integer):string; +var + dummy : integer; +begin + {$ifdef win32} + if usewindns then begin + result := winreverselookup(ip,dummy); + exit; + end; + {$endif} + setstate_reverse(ip,state); + resolveloop(timeout); + result := state.resultstr; +end; + +{$ifdef win32} + var + wsadata : twsadata; + + initialization + WSAStartUp($2,wsadata); + finalization + WSACleanUp; +{$endif} +end. + + diff --git a/dnswin.pas b/dnswin.pas new file mode 100755 index 0000000..7d986d1 --- /dev/null +++ b/dnswin.pas @@ -0,0 +1,332 @@ +unit dnswin; + +interface +uses binipstuff,classes,lcore; + +//on failure a null string or zeroed out binip will be retuned and error will be +//set to a windows error code (error will be left untouched under non error +//conditions). +function winforwardlookup(name : string;ipv6preffered : boolean;var error:integer) : tbinip; +function winreverselookup(ip:tbinip;var error:integer):string; + + +type + //do not call destroy on a tdnswinasync instead call release and the + //dnswinasync will be freed when appropriate. Calling destroy will block + //the calling thread until the dns lookup completes. + //release should only be called from the main thread + tdnswinasync=class(tthread) + private + ipv6preffered : boolean; + freverse : boolean; + error : integer; + freewhendone : boolean; + hadevent : boolean; + protected + procedure execute; override; + public + onrequestdone:tsocketevent; + name : string; + ip : tbinip; + + procedure forwardlookup(name:string;ipv6preffered:boolean); + procedure reverselookup(ip:tbinip); + destructor destroy; override; + procedure release; + constructor create; + property reverse : boolean read freverse; + + end; + +implementation +uses + lsocket,pgtypes,sysutils,winsock,windows,messages; + +type + //taddrinfo = record; //forward declaration + paddrinfo = ^taddrinfo; + taddrinfo = packed record + ai_flags : longint; + ai_family : longint; + ai_socktype : longint; + ai_protocol : longint; + ai_addrlen : taddrint; + ai_canonname : pchar; + ai_addr : pinetsockaddrv; + ai_next : paddrinfo; + end; + ppaddrinfo = ^paddrinfo; + tgetaddrinfo = function(nodename : pchar; servname : pchar; hints : paddrinfo;res : ppaddrinfo) : longint; stdcall; + tfreeaddrinfo = procedure(ai : paddrinfo); stdcall; + tgetnameinfo = function(sa:Pinetsockaddrv;salen : longint; host:pchar;hostlen : longint;serv:pchar;servlen:longint;flags:longint) : longint;stdcall; +var + getaddrinfo : tgetaddrinfo; + freeaddrinfo : tfreeaddrinfo; + getnameinfo : tgetnameinfo; +procedure v4onlyfreeaddrinfo(ai : paddrinfo); stdcall; +begin + freemem(ai.ai_addr); + freemem(ai); +end; + +type + plongint = ^longint; + pplongint = ^plongint; + +function v4onlygetaddrinfo(nodename : pchar; servname : pchar; hints : paddrinfo;res : ppaddrinfo) : longint; stdcall; +var + output : paddrinfo; + hostent : phostent; +begin + if hints.ai_family = af_inet then begin + result := 0; + getmem(output,sizeof(taddrinfo)); + getmem(output.ai_addr,sizeof(tinetsockaddr)); + output.ai_addr.InAddr.family := af_inet; + if servname <> nil then output.ai_addr.InAddr.port := htons(strtoint(servname)) else output.ai_addr.InAddr.port := 0; + hostent := gethostbyname(nodename); + if hostent = nil then begin + result := wsagetlasterror; + v4onlyfreeaddrinfo(output); + exit; + end; + output.ai_addr.InAddr.addr := pplongint(hostent.h_addr_list)^^; + output.ai_flags := 0; + output.ai_family := af_inet; + output.ai_socktype := 0; + output.ai_protocol := 0; + output.ai_addrlen := sizeof(tinetsockaddr); + output.ai_canonname := nil; + output.ai_next := nil; + + res^ := output; + end else begin + result := WSANO_RECOVERY; + end; +end; + +function min(a,b : integer):integer; +begin + if a 0 then begin + fillchar(result,0,sizeof(result)); + error := getaddrinforesult; + end; +end; + +function winreverselookup(ip:tbinip;var error : integer):string; +var + sa : tinetsockaddrv; + getnameinforesult : integer; +begin + + if ip.family = AF_INET then begin + sa.InAddr.family := AF_INET; + sa.InAddr.port := 1; + sa.InAddr.addr := ip.ip; + end else {$ifdef ipv6}if ip.family = AF_INET6 then begin + sa.InAddr6.sin6_family := AF_INET6; + sa.InAddr6.sin6_port := 1; + sa.InAddr6.sin6_addr := ip.ip6; + end else{$endif} begin + raise exception.create('unrecognised address family'); + end; + populateprocvars; + setlength(result,1025); + getnameinforesult := getnameinfo(@sa,sizeof(tinetsockaddrv),pchar(result),length(result),nil,0,0); + if getnameinforesult <> 0 then begin + error := getnameinforesult; + result := ''; + exit; + end; + if pos(#0,result) >= 0 then begin + setlength(result,pos(#0,result)-1); + end; +end; + +var + hwnddnswin : hwnd; + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + dwas : tdnswinasync; +begin + if (ahwnd=hwnddnswin) and (aumsg=wm_user) then begin + Dwas := tdnswinasync(alparam); + if assigned (dwas.onrequestdone) then dwas.onrequestdone(dwas,awparam); + dwas.hadevent := true; + if dwas.freewhendone then dwas.free; + end else begin + //not passing unknown messages on to defwindowproc will cause window + //creation to fail! --plugwash + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; +end; + +procedure tdnswinasync.forwardlookup(name:string;ipv6preffered:boolean); +begin + self.name := name; + self.ipv6preffered := ipv6preffered; + freverse := false; + resume; +end; +procedure tdnswinasync.reverselookup(ip:tbinip); +begin + self.ip := ip; + freverse := true; + resume; +end; +procedure tdnswinasync.execute; +var + error : integer; +begin + error := 0; + if reverse then begin + name := winreverselookup(ip,error); + end else begin + ip := winforwardlookup(name,ipv6preffered,error); + + end; + + postmessage(hwnddnswin,wm_user,error,taddrint(self)); +end; + +destructor tdnswinasync.destroy; +begin + WaitFor; + inherited destroy; +end; +procedure tdnswinasync.release; +begin + if hadevent then destroy else begin + onrequestdone := nil; + freewhendone := true; + end; +end; + +constructor tdnswinasync.create; +begin + inherited create(true); +end; + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'dnswinClass'); +begin + + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create lcore handle, hinstance=',hinstance); + hwnddnswin := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + //writeln('dnswin hwnd is ',hwnddnswin); + //writeln('last error is ',GetLastError); +end. diff --git a/fd_utils.pas b/fd_utils.pas new file mode 100755 index 0000000..ea6e833 --- /dev/null +++ b/fd_utils.pas @@ -0,0 +1,74 @@ +// this file contains code copied from linux.pp in the free pascal rtl +// i had to copy them because i use a different definition of fdset to them +// the copyright block from the file in question is shown below +{ + $Id: fd_utils.pas,v 1.2 2004/08/19 23:12:09 plugwash Exp $ + This file is part of the Free Pascal run time library. + Copyright (c) 1999-2000 by Michael Van Canneyt, + BSD parts (c) 2000 by Marco van de Voort + members of the Free Pascal development team. + + See the file COPYING.FPC, included in this distribution, + for details about the copyright. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY;without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. + +**********************************************************************} +{$ifdef fpc} + {$mode delphi} + {$inlining on} +{$endif} +unit fd_utils; +interface + +type + FDSet= Array [0..255] of longint; {31} + PFDSet= ^FDSet; +const + absoloutemaxs=(sizeof(fdset)*8)-1; + +Procedure FD_Clr(fd:longint;var fds:fdSet); +Procedure FD_Zero(var fds:fdSet); +Procedure FD_Set(fd:longint;var fds:fdSet); +Function FD_IsSet(fd:longint;var fds:fdSet):boolean; + +{$ifdef fpc} + {$ifndef ver1_0} + {$define useinline} + {$endif} +{$endif} + +implementation +uses sysutils; +Procedure FD_Clr(fd:longint;var fds:fdSet);{$ifdef useinline}inline;{$endif} +{ Remove fd from the set of filedescriptors} +begin + if (fd < 0) then raise exception.create('FD_Clr fd out of range: '+inttostr(fd)); + fds[fd shr 5]:=fds[fd shr 5] and (not (1 shl (fd and 31))); +end; + +Procedure FD_Zero(var fds:fdSet); +{ Clear the set of filedescriptors } +begin + FillChar(fds,sizeof(fdSet),0); +end; + +Procedure FD_Set(fd:longint;var fds:fdSet);{$ifdef useinline}inline;{$endif} +{ Add fd to the set of filedescriptors } +begin + if (fd < 0) then raise exception.create('FD_set fd out of range: '+inttostr(fd)); + fds[fd shr 5]:=fds[fd shr 5] or (1 shl (fd and 31)); +end; + +Function FD_IsSet(fd:longint;var fds:fdSet):boolean;{$ifdef useinline}inline;{$endif} +{ Test if fd is part of the set of filedescriptors } +begin + if (fd < 0) then begin + result := false; + exit; + end; + FD_IsSet:=((fds[fd shr 5] and (1 shl (fd and 31)))<>0); +end; +end. diff --git a/httpserver_20080306/bfifo.pas b/httpserver_20080306/bfifo.pas new file mode 100755 index 0000000..55cc24a --- /dev/null +++ b/httpserver_20080306/bfifo.pas @@ -0,0 +1,148 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit bfifo; +{$ifdef fpc} + {$mode delphi} +{$endif} + +interface + +uses blinklist,pgtypes; + +const + pagesize=1420; + +type + tfifo=class(tobject) + private + l:tlinklist; {add to} + getl:tlinklist; {remove from} + ofs:integer; + getofs:integer; + public + size:integer; + procedure add(data:pointer;len:integer); + function get(var resultptr:pointer;len:integer):integer; + procedure del(len:integer); + constructor create; + destructor destroy; override; + end; + + +implementation + +var + testcount:integer; + +{ + +xx1..... add +xxxxxxxx +....2xxx delete + +1 ofs +2 getofs + +} + +procedure tfifo.add; +var + a:integer; + p:tlinklist; +begin + if len <= 0 then exit; + inc(size,len); + while len > 0 do begin + p := l; + if ofs = pagesize then begin + p := tplinklist.create; + if getl = nil then getl := p; + getmem(tplinklist(p).p,pagesize); + inc(testcount); + linklistadd(l,p); + ofs := 0; + end; + a := pagesize - ofs; + if len < a then a := len; + move(data^,pointer(taddrint(tplinklist(p).p)+ofs)^,a); + inc(taddrint(data),a); + dec(len,a); + inc(ofs,a); + end; +end; + +function tfifo.get; +var + p:tlinklist; + a:integer; +begin + if len > size then len := size; + if len <= 0 then begin + result := 0; + resultptr := nil; + exit; + end; + p := getl; + resultptr := pointer(taddrint(tplinklist(p).p)+getofs); + result := pagesize-getofs; + if result > len then result := len; +end; + +procedure tfifo.del; +var + a:integer; + p,p2:tlinklist; +begin + if len <= 0 then exit; + p := getl; + if len > size then len := size; + dec(size,len); + + if len = 0 then exit; + + while len > 0 do begin + a := pagesize-getofs; + if a > len then a := len; + inc(getofs,a); + dec(len,a); + if getofs = pagesize then begin + p2 := p.prev; + freemem(tplinklist(p).p); + dec(testcount); + linklistdel(l,p); + p.destroy; + p := p2; + getl := p; + getofs := 0; + end; + end; + + if size = 0 then begin + if assigned(l) then begin + p := l; + freemem(tplinklist(p).p); + dec(testcount); + linklistdel(l,p); + p.destroy; + getl := nil; + end; + ofs := pagesize; + getofs := 0; + end; +end; + +constructor tfifo.create; +begin + ofs := pagesize; + inherited create; +end; + +destructor tfifo.destroy; +begin + del(size); + inherited destroy; +end; + +end. diff --git a/httpserver_20080306/binipstuff.pas b/httpserver_20080306/binipstuff.pas new file mode 100755 index 0000000..ebb9f9c --- /dev/null +++ b/httpserver_20080306/binipstuff.pas @@ -0,0 +1,395 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit binipstuff; + +interface + +{$ifndef win32} +{$ifdef ipv6} +uses sockets; +{$endif} +{$endif} + +{$ifdef fpc} + {$mode delphi} +{$endif} +{$ifdef cpu386}{$define i386}{$endif} +{$ifdef i386}{$define ENDIAN_LITTLE}{$endif} + +{$include uint32.inc} + +const + hexchars:array[0..15] of char='0123456789abcdef'; + AF_INET=2; + {$ifdef win32} + AF_INET6=23; + {$else} + AF_INET6=10; + {$endif} + +type + {$ifdef ipv6} + + {$ifdef win32} + {$define want_Tin6_addr} + {$endif} + {$ifdef ver1_0} + {$define want_Tin6_addr} + {$endif} + {$ifdef want_Tin6_addr} + Tin6_addr = packed record + case byte of + 0: (u6_addr8 : array[0..15] of byte); + 1: (u6_addr16 : array[0..7] of Word); + 2: (u6_addr32 : array[0..3] of uint32); + 3: (s6_addr8 : array[0..15] of shortint); + 4: (s6_addr : array[0..15] of shortint); + 5: (s6_addr16 : array[0..7] of smallint); + 6: (s6_addr32 : array[0..3] of LongInt); + end; + {$endif} + {$endif} + + tbinip=record + family:integer; + {$ifdef ipv6} + case integer of + 0: (ip:longint); + 1: (ip6:tin6_addr); + {$else} + ip:longint; + {$endif} + end; + + {$ifdef win32} + TInetSockAddr = packed Record + family:Word; + port :Word; + addr :uint32; + pad :array [1..8] of byte; + end; + {$ifdef ipv6} + + TInetSockAddr6 = packed record + sin6_family: word; + sin6_port: word; + sin6_flowinfo: uint32; + sin6_addr: tin6_addr; + sin6_scope_id: uint32; + end; + {$endif} + {$endif} + +function htons(w:word):word; +function htonl(i:uint32):uint32; + +function ipstrtobin(const s:string;var binip:tbinip):boolean; +function ipbintostr(const binip:tbinip):string; +{$ifdef ipv6} +function ip6bintostr(const bin:tin6_addr):string; +function ip6strtobin(const s:string;var bin:tin6_addr):boolean; +{$endif} + +function comparebinip(const ip1,ip2:tbinip):boolean; + +{deprecated} +function longip(s:string):longint; + +procedure converttov4(var ip:tbinip); + +implementation + +uses sysutils; + +function htons(w:word):word; +begin + {$ifdef ENDIAN_LITTLE} + result := ((w and $ff00) shr 8) or ((w and $ff) shl 8); + {$else} + result := w; + {$endif} +end; + +function htonl(i:uint32):uint32; +begin + {$ifdef ENDIAN_LITTLE} + result := (i shr 24) or (i shr 8 and $ff00) or (i shl 8 and $ff0000) or (i shl 24 and $ff000000); + {$else} + result := i; + {$endif} +end; + +{internal} +{converts dotted v4 IP to longint. returns host endian order} +function longip(s:string):longint; +var + l:longint; + a,b:integer; +function convertbyte(const s:string):integer; +begin + result := strtointdef(s,-1); + if result < 0 then begin + result := -1; + exit; + end; + if result > 255 then begin + result := -1; + exit; + end; + {01 exception} + if (result <> 0) and (s[1] = '0') then begin + result := -1; + exit; + end; + {+1 exception} + if not (s[1] in ['0'..'9']) then begin + result := -1; + exit + end; +end; + +begin + result := 0; + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := b shl 24; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 16; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 8; + s := copy(s,a+1,256); + b := convertbyte(copy(s,1,256));if (b < 0) then exit; + l := l or b; + result := l; +end; + + +function ipstrtobin(const s:string;var binip:tbinip):boolean; +begin + binip.family := 0; + result := false; + {$ifdef ipv6} + if pos(':',s) <> 0 then begin + {try ipv6. use builtin routine} + result := ip6strtobin(s,binip.ip6); + if result then binip.family := AF_INET6; + exit; + end; + {$endif} + + {try v4} + binip.ip := htonl(longip(s)); + if (binip.ip <> 0) or (s = '0.0.0.0') then begin + result := true; + binip.family := AF_INET; + exit; + end; +end; + +function ipbintostr(const binip:tbinip):string; +var + a:integer; +begin + result := ''; + {$ifdef ipv6} + if binip.family = AF_INET6 then begin + result := ip6bintostr(binip.ip6); + end else + {$endif} + if binip.family = AF_INET then begin + a := htonl(binip.ip); + result := inttostr(a shr 24)+'.'+inttostr((a shr 16) and $ff)+'.'+inttostr((a shr 8) and $ff)+'.'+inttostr(a and $ff); + end; +end; + + +{------------------------------------------------------------------------------} + +{$ifdef ipv6} + +{ +IPv6 address binary to/from string conversion routines +written by beware (steendijk at xs4all dot nl) + +- implementation does not depend on other ipv6 code such as the tin6_addr type, + the parameter can also be untyped. +- it is host endian neutral - binary format is aways network order +- it supports compression of zeroes +- it supports ::ffff:192.168.12.34 style addresses +- they are made to do the Right Thing, more efficient implementations are possible +} + +{fpc has hostaddrtostr6 and strtohostaddr6 but the later isnt implemented yet} + + +function ip6bintostr(const bin:tin6_addr):string; +{base16 with lowercase output} +function makehex(w:word):string; +begin + result := ''; + if w >= 4096 then result := result + hexchars[w shr 12]; + if w >= 256 then result := result + hexchars[w shr 8 and $f]; + if w >= 16 then result := result + hexchars[w shr 4 and $f]; + result := result + hexchars[w and $f]; +end; + +var + a,b,c,addrlen:integer; + runbegin,runlength:integer; + bytes:array[0..15] of byte absolute bin; + words:array[0..7] of word; + dwords:array[0..3] of integer absolute words; +begin + for a := 0 to 7 do begin + words[a] := bytes[a shl 1] shl 8 or bytes[a shl 1 or 1]; + end; + if (dwords[0] = 0) and (dwords[1] = 0) and (words[4] = 0) and (words[5] = $ffff) then begin + {::ffff:/96 exception: v4 IP} + addrlen := 6; + end else begin + addrlen := 8; + end; + {find longest run of zeroes} + runbegin := 0; + runlength := 0; + for a := 0 to addrlen-1 do begin + if words[a] = 0 then begin + c := 0; + for b := a to addrlen-1 do if words[b] = 0 then begin + inc(c); + end else break; + if (c > runlength) then begin + runlength := c; + runbegin := a; + end; + end; + end; + result := ''; + for a := 0 to runbegin-1 do begin + if (a <> 0) then result := result + ':'; + result := result + makehex(words[a]); + end; + if runlength > 0 then result := result + '::'; + c := runbegin+runlength; + for a := c to addrlen-1 do begin + if (a > c) then result := result + ':'; + result := result + makehex(words[a]); + end; + if addrlen = 6 then begin + result := result + ':'+inttostr(bytes[12])+'.'+inttostr(bytes[13])+'.'+inttostr(bytes[14])+'.'+inttostr(bytes[15]); + end; +end; + +function ip6strtobin(const s:string;var bin:tin6_addr):boolean; +var + a,b:integer; + fields:array[0..7] of string; + fieldcount:integer; + emptyfield:integer; + wordcount:integer; + words:array[0..7] of word; + bytes:array[0..15] of byte absolute bin; +begin + result := false; + for a := 0 to 7 do fields[a] := ''; + fieldcount := 0; + for a := 1 to length(s) do begin + if s[a] = ':' then inc(fieldcount) else fields[fieldcount] := fields[fieldcount] + s[a]; + if fieldcount > 7 then exit; + end; + if fieldcount < 2 then exit; + + {find the empty field (compressed zeroes), not counting the first and last there may be at most 1} + emptyfield := -1; + for a := 1 to fieldcount-1 do begin + if fields[a] = '' then begin + if emptyfield = -1 then emptyfield := a else exit; + end; + end; + + {check if last field is a valid v4 IP} + a := longip(fields[fieldcount]); + if (a <> 0) or (fields[fieldcount] = '0.0.0.0') then wordcount := 6 else wordcount := 8; + {0:1:2:3:4:5:6.6.6.6 + 0:1:2:3:4:5:6:7} + fillchar(words,sizeof(words),0); + if wordcount = 6 then begin + if fieldcount > 6 then exit; + words[6] := a shr 16; + words[7] := a and $ffff; + end; + if emptyfield = -1 then begin + {no run length: must be an exact number of fields} + if wordcount = 6 then begin + if fieldcount <> 6 then exit; + emptyfield := 5; + end else if wordcount = 8 then begin + if fieldcount <> 7 then exit; + emptyfield := 7; + end else exit; + end; + for a := 0 to emptyfield do begin + if fields[a] = '' then b := 0 else b := strtointdef('$'+fields[a],-1); + if (b < 0) or (b > $ffff) then exit; + words[a] := b; + end; + if wordcount = 6 then dec(fieldcount); + for a := wordcount-1 downto wordcount-(fieldcount-emptyfield) do begin + b := a+fieldcount-wordcount+1; + if fields[b] = '' then b := 0 else b := strtointdef('$'+fields[b],-1); + if (b < 0) or (b > $ffff) then exit; + words[a] := b; + end; + for a := 0 to 7 do begin + bytes[a shl 1] := words[a] shr 8; + bytes[a shl 1 or 1] := words[a] and $ff; + end; + result := true; +end; +{$endif} + +function comparebinip(const ip1,ip2:tbinip):boolean; +begin + if (ip1.ip <> ip2.ip) then begin + result := false; + exit; + end; + + {$ifdef ipv6} + if ip1.family = AF_INET6 then begin + if (ip1.ip6.s6_addr32[1] <> ip2.ip6.s6_addr32[1]) + or (ip1.ip6.s6_addr32[2] <> ip2.ip6.s6_addr32[2]) + or (ip1.ip6.s6_addr32[3] <> ip2.ip6.s6_addr32[3]) then begin + result := false; + exit; + end; + end; + {$endif} + + result := (ip1.family = ip2.family); +end; + +{converts a binary IP to v4 if it is a v6 IP in the v4 range} +procedure converttov4(var ip:tbinip); +begin + {$ifdef ipv6} + if ip.family = AF_INET6 then begin + if (ip.ip6.u6_addr32[0] = 0) and (ip.ip6.u6_addr32[1] = 0) and + (ip.ip6.u6_addr16[4] = 0) and (ip.ip6.u6_addr16[5] = $ffff) then begin + ip.family := AF_INET; + ip.ip := ip.ip6.s6_addr32[3]; + end; + end; + {$endif} +end; + +end. diff --git a/httpserver_20080306/blinklist.pas b/httpserver_20080306/blinklist.pas new file mode 100755 index 0000000..2079b75 --- /dev/null +++ b/httpserver_20080306/blinklist.pas @@ -0,0 +1,118 @@ +(* + * beware IRC services, blinklist.pas + * Copyright (C) 2002 Bas Steendijk + * + * This program is free software; you can redistribute it and/or modify + * it under the terms of the GNU General Public License as published by + * the Free Software Foundation; either version 2 of the License, or + * (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with this program; if not, write to the Free Software + * Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + *) +unit blinklist; +{$ifdef fpc} + {$mode delphi} +{$endif} + + +interface + +type + tlinklist=class(tobject) + next:tlinklist; + prev:tlinklist; + constructor create; + destructor destroy; override; + end; + + {linklist with 2 links} + tlinklist2=class(tlinklist) + next2:tlinklist2; + prev2:tlinklist2; + end; + + {linklist with one pointer} + tplinklist=class(tlinklist) + p:pointer + end; + + tstringlinklist=class(tlinklist) + s:string; + end; + + tthing=class(tlinklist) + name:string; {name/nick} + hashname:integer; {hash of name} + end; + +{ +adding new block to list (baseptr) +} +procedure linklistadd(var baseptr:tlinklist;newptr:tlinklist); +procedure linklistdel(var baseptr:tlinklist;item:tlinklist); + + +procedure linklist2add(var baseptr,newptr:tlinklist2); +procedure linklist2del(var baseptr:tlinklist2;item:tlinklist2); + +var + linklistdebug:integer; + +implementation + +procedure linklistadd(var baseptr:tlinklist;newptr:tlinklist); +var + p:tlinklist; +begin + p := baseptr; + baseptr := newptr; + baseptr.prev := nil; + baseptr.next := p; + if p <> nil then p.prev := baseptr; +end; + +procedure linklistdel(var baseptr:tlinklist;item:tlinklist); +begin + if item = baseptr then baseptr := item.next; + if item.prev <> nil then item.prev.next := item.next; + if item.next <> nil then item.next.prev := item.prev; +end; + +procedure linklist2add(var baseptr,newptr:tlinklist2); +var + p:tlinklist2; +begin + p := baseptr; + baseptr := newptr; + baseptr.prev2 := nil; + baseptr.next2 := p; + if p <> nil then p.prev2 := baseptr; +end; + +procedure linklist2del(var baseptr:tlinklist2;item:tlinklist2); +begin + if item = baseptr then baseptr := item.next2; + if item.prev2 <> nil then item.prev2.next2 := item.next2; + if item.next2 <> nil then item.next2.prev2 := item.prev2; +end; + +constructor tlinklist.create; +begin + inherited create; + inc(linklistdebug); +end; + +destructor tlinklist.destroy; +begin + dec(linklistdebug); + inherited destroy; +end; + +end. diff --git a/httpserver_20080306/bsearchtree.pas b/httpserver_20080306/bsearchtree.pas new file mode 100755 index 0000000..ad61751 --- /dev/null +++ b/httpserver_20080306/bsearchtree.pas @@ -0,0 +1,101 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{actually a hashtable. it was a tree in earlier versions} + +unit bsearchtree; + +interface + +uses blinklist; + +const + hashtable_size=$4000; + +type + thashitem=class(tlinklist) + hash:integer; + s:string; + p:pointer; + end; + thashtable=array[0..hashtable_size-1] of thashitem; + phashtable=^thashtable; + +{adds "item" to the tree for name "s". the name must not exist (no checking done)} +procedure addtree(t:phashtable;s:string;item:pointer); + +{removes name "s" from the tree. the name must exist (no checking done)} +procedure deltree(t:phashtable;s:string); + +{returns the item pointer for s, or nil if not found} +function findtree(t:phashtable;s:string):pointer; + +implementation + +function makehash(s:string):integer; +const + shifter=6; +var + a,b:integer; +begin + result := 0; + b := length(s); + for a := 1 to b do begin + result := (result shl shifter) xor byte(s[a]); + end; + result := (result xor result shr 16) and (hashtable_size-1); +end; + +procedure addtree(t:phashtable;s:string;item:pointer); +var + hash:integer; + p:thashitem; +begin + hash := makehash(s); + p := thashitem.create; + p.hash := hash; + p.s := s; + p.p := item; + linklistadd(tlinklist(t[hash]),tlinklist(p)); +end; + +procedure deltree(t:phashtable;s:string); +var + p,p2:thashitem; + hash:integer; +begin + hash := makehash(s); + p := t[hash]; + p2 := nil; + while p <> nil do begin + if p.s = s then begin + p2 := p; + break; + end; + p := thashitem(p.next); + end; + linklistdel(tlinklist(t[hash]),tlinklist(p2)); + p2.destroy; +end; + + +function findtree(t:phashtable;s:string):pointer; +var + p:thashitem; + hash:integer; +begin + result := nil; + hash := makehash(s); + p := t[hash]; + while p <> nil do begin + if p.s = s then begin + result := p.p; + exit; + end; + p := thashitem(p.next); + end; +end; + +end. diff --git a/httpserver_20080306/btime.pas b/httpserver_20080306/btime.pas new file mode 100755 index 0000000..127839e --- /dev/null +++ b/httpserver_20080306/btime.pas @@ -0,0 +1,362 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +{ +this unit returns unix timestamp with seconds and microseconds (as float) +works on windows/delphi, and on freepascal on unix. +} + +unit btime; + +interface + +type + float=extended; + +var + timezone:integer; + timezonestr:string; + irctime,unixtime:integer; + tickcount:integer; + settimebias:integer; + qpcjump:float; {can be read out and reset for debug purpose} + performancecountfreq:extended; + +function irctimefloat:float; +function irctimeint:integer; + +function unixtimefloat:float; +function unixtimeint:integer; + +function wintimefloat:float; + +procedure settime(newtime:integer); +procedure gettimezone; +procedure timehandler; +procedure init; + +function timestring(i:integer):string; +function timestrshort(i:integer):string; + +function oletounixfloat(t:float):float; +function oletounix(t:tdatetime):integer; +function unixtoole(i:integer):tdatetime; + +var + timefloatbias:float; + lastunixtimefloat:float=0; + +implementation + +{$ifdef fpc} + {$mode delphi} +{$endif} + +uses + {$ifdef UNIX} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, {needed for 2.0.2} + {$endif} + {$else} + windows, + {$endif} + sysutils; + + {$include unixstuff.inc} + + +const + daysdifference=25569; + +function oletounixfloat(t:float):float; +begin + t := (t - daysdifference) * 86400; + result := t; +end; + +function oletounix(t:tdatetime):integer; +begin + result := trunc(oletounixfloat(t)); +end; + +function unixtoole(i:integer):tdatetime; +begin + result := ((i)/86400)+daysdifference; +end; + +{$ifdef unix} +{-----------------------------------------*nix/freepascal code to read time } + +function unixtimefloat:float; +var + tv:ttimeval; +begin + gettimeofday(tv); + result := tv.tv_sec+(tv.tv_usec/1000000); +end; + +function wintimefloat:extended; +begin + result := unixtimefloat; +end; + +function unixtimeint:integer; +var + tv:ttimeval; +begin + gettimeofday(tv); + result := tv.tv_sec; +end; + +{$else} {delphi 3} +{------------------------------ windows/delphi code to read time} + +{ free pascals tsystemtime is incomaptible with windows api calls + so we declare it ourselves - plugwash +} +{$ifdef fpc} +type + TSystemTime = record + wYear: Word; + wMonth: Word; + wDayOfWeek: Word; + wDay: Word; + wHour: Word; + wMinute: Word; + wSecond: Word; + wMilliseconds: Word; + end; + {$endif} +function Date_utc: extended; +var + SystemTime: TSystemTime; +begin + {$ifdef fpc} + GetsystemTime(@SystemTime); + {$else} + GetsystemTime(SystemTime); + {$endif} + with SystemTime do Result := EncodeDate(wYear, wMonth, wDay); +end; + +function Time_utc: extended; +var + SystemTime: TSystemTime; +begin + {$ifdef fpc} + GetsystemTime(@SystemTime); + {$else} + GetsystemTime(SystemTime); + {$endif} + with SystemTime do + Result := EncodeTime(wHour, wMinute, wSecond, wMilliSeconds); +end; + +function Now_utc: extended; +begin + Result := round(Date_utc) + Time_utc; +end; + +const + highdwordconst=4294967296.0; + +function wintimefloat:extended; +var + p:packed record + lowpart:longint; + highpart:longint + end; + p2:tlargeinteger absolute p; + e:extended; +begin + if performancecountfreq = 0 then begin + QueryPerformancefrequency(p2); + e := p.lowpart; + if e < 0 then e := e + highdwordconst; + performancecountfreq := ((p.highpart*highdwordconst)+e); + end; + queryperformancecounter(p2); + e := p.lowpart; + if e < 0 then e := e + highdwordconst; + result := ((p.highpart*highdwordconst)+e)/performancecountfreq; +end; + +var + classpriority,threadpriority:integer; + +procedure settc; +var + hprocess,hthread:integer; +begin + hProcess := GetCurrentProcess; + hThread := GetCurrentThread; + + ClassPriority := GetPriorityClass(hProcess); + ThreadPriority := GetThreadPriority(hThread); + + SetPriorityClass(hProcess, REALTIME_PRIORITY_CLASS); + SetThreadPriority(hThread, THREAD_PRIORITY_TIME_CRITICAL); +end; + +procedure unsettc; +var + hprocess,hthread:integer; +begin + hProcess := GetCurrentProcess; + hThread := GetCurrentThread; + + SetPriorityClass(hProcess, ClassPriority); + SetThreadPriority(hThread, ThreadPriority); +end; + +function unixtimefloat:float; +var + f,g,h:float; +begin + if timefloatbias = 0 then begin + settc; + f := now_utc; + repeat g := now_utc; h := wintimefloat until g > f; + timefloatbias := oletounixfloat(g)-h; + unsettc; + end; + result := wintimefloat+timefloatbias; + + { + workaround for QPC jumps + (approach 2: always check "hi res" QPC unixtime against the "guaranteed" systemtime one) + } + f := result-(oletounixfloat(now_utc)); + if abs(f) > 0.02 then begin + f := timefloatbias; + timefloatbias := 0; + result := unixtimefloat; + qpcjump := qpcjump + f - timefloatbias; + end; + + if (result <= lastunixtimefloat) then result := lastunixtimefloat + 0.0000001; + lastunixtimefloat := result; +end; + +function unixtimeint:integer; +begin + result := trunc(unixtimefloat); +end; + +{$endif} +{-----------------------------------------------end of platform specific} + +function irctimefloat:float; +begin + result := unixtimefloat+settimebias; +end; + +function irctimeint:integer; +begin + result := unixtimeint+settimebias; +end; + + +procedure settime(newtime:integer); +var + a:integer; +begin + a := irctimeint-settimebias; + if newtime = 0 then settimebias := 0 else settimebias := newtime-a; + + irctime := irctimeint; +end; + +procedure timehandler; +begin + if unixtime = 0 then init; + unixtime := unixtimeint; + irctime := irctimeint; + if unixtime and 63 = 0 then begin + {update everything, apply timezone changes, clock changes, etc} + gettimezone; + timefloatbias := 0; + unixtime := unixtimeint; + irctime := irctimeint; + end; +end; + + +procedure gettimezone; +var + {$ifdef UNIX} + {$ifndef ver1_9_4} + {$ifndef ver1_0} + {$define above194} + {$endif} + {$endif} + {$ifndef above194} + hh,mm,ss:word; + {$endif} + {$endif} + l:integer; +begin + {$ifdef UNIX} + {$ifdef above194} + timezone := tzseconds; + {$else} + gettime(hh,mm,ss); + timezone := (longint(hh) * 3600 + mm * 60 + ss) - (unixtimeint mod 86400); + {$endif} + {$else} + timezone := round((now-now_utc)*86400); + {$endif} + + while timezone > 43200 do dec(timezone,86400); + while timezone < -43200 do inc(timezone,86400); + + if timezone >= 0 then timezonestr := '+' else timezonestr := '-'; + l := abs(timezone) div 60; + timezonestr := timezonestr + char(l div 600 mod 10+48)+char(l div 60 mod 10+48)+':'+char(l div 10 mod 6+48)+char(l mod 10+48); +end; + +function timestrshort(i:integer):string; +const + weekday:array[0..6] of string[4]=('Thu','Fri','Sat','Sun','Mon','Tue','Wed'); + month:array[0..11] of string[4]=('Jan','Feb','Mar','Apr','May','Jun','Jul','Aug','Sep','Oct','Nov','Dec'); +var + y,m,d,h,min,sec,ms:word; + t:tdatetime; +begin + t := unixtoole(i+timezone); + decodedate(t,y,m,d); + decodetime(t,h,min,sec,ms); + result := weekday[(i+timezone) div 86400 mod 7]+' '+month[m-1]+' '+inttostr(d)+' '+ + inttostr(h div 10)+inttostr(h mod 10)+':'+inttostr(min div 10)+inttostr(min mod 10)+':'+inttostr(sec div 10)+inttostr(sec mod 10)+' '+ + inttostr(y); +end; + +function timestring(i:integer):string; +const + weekday:array[0..6] of string[10]=('Thursday','Friday','Saturday','Sunday','Monday','Tuesday','Wednesday'); + month:array[0..11] of string[10]=('January','February','March','April','May','June','July','August','September','October','November','December'); +var + y,m,d,h,min,sec,ms:word; + t:tdatetime; +begin + t := unixtoole(i+timezone); + decodedate(t,y,m,d); + decodetime(t,h,min,sec,ms); + result := weekday[(i+timezone) div 86400 mod 7]+' '+month[m-1]+' '+inttostr(d)+' '+inttostr(y)+' -- '+ + inttostr(h div 10)+inttostr(h mod 10)+':'+inttostr(min div 10)+inttostr(min mod 10)+':'+inttostr(sec div 10)+inttostr(sec mod 10)+' '+ + timezonestr; +end; + +procedure init; +begin + qpcjump := 0; + settimebias := 0; + gettimezone; + unixtime := unixtimeint; + irctime := irctimeint; +end; + +end. diff --git a/httpserver_20080306/dnsasync.pas b/httpserver_20080306/dnsasync.pas new file mode 100755 index 0000000..682f95f --- /dev/null +++ b/httpserver_20080306/dnsasync.pas @@ -0,0 +1,241 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +//FIXME: this code only ever seems to use one dns server for a request and does +//not seem to have any form of retry code. + +unit dnsasync; + +interface + +uses + {$ifdef win32} + dnswin, + {$endif} + lsocket,lcore, + classes,binipstuff,dnscore,btime; + + +type + //after completion or cancelation a dnswinasync may be reused + tdnsasync=class(tcomponent) + + private + //made a load of stuff private that does not appear to be part of the main + //public interface. If you make any of it public again please consider the + //consequences when using windows dns. --plugwash. + sock:twsocket; + + sockopen:boolean; + + + state:tdnsstate; + + dnsserverid:integer; + startts:double; + {$ifdef win32} + dwas : tdnswinasync; + {$endif} + + + procedure asyncprocess; + procedure receivehandler(sender:tobject;error:word); + function sendquery(const packet:tdnspacket;len:integer):boolean; + {$ifdef win32} + procedure winrequestdone(sender:tobject;error:word); + {$endif} + public + onrequestdone:tsocketevent; + + //addr and port allow the application to specify a dns server specifically + //for this dnsasync object. This is not a reccomended mode of operation + //because it limits the app to one dns server but is kept for compatibility + //and special uses. + addr,port:string; + + //A family value of AF_INET6 will give only + //ipv6 results. Any other value will give ipv4 results in preference and ipv6 + //results if ipv4 results are not available; + forwardfamily:integer; + + procedure cancel;//cancel an outstanding dns request + function dnsresult:string; //get result of dnslookup as a string + procedure dnsresultbin(var binip:tbinip); //get result of dnslookup as a tbinip + procedure forwardlookup(const name:string); //start forward lookup, + //preffering ipv4 + procedure reverselookup(const binip:tbinip); //start reverse lookup + + constructor create(aowner:tcomponent); override; + destructor destroy; override; + + end; + +implementation + +uses sysutils; + +constructor tdnsasync.create; +begin + inherited create(aowner); + dnsserverid := -1; + sock := twsocket.create(self); +end; + +destructor tdnsasync.destroy; +begin + if dnsserverid >= 0 then begin + reportlag(dnsserverid,-1); + dnsserverid := -1; + end; + sock.release; + setstate_request_init('',state); + inherited destroy; +end; + +procedure tdnsasync.receivehandler; +begin + if dnsserverid >= 0 then begin + reportlag(dnsserverid,trunc((unixtimefloat-startts)*1000)); + dnsserverid := -1; + end; +{ writeln('received reply');} + fillchar(state.recvpacket,sizeof(state.recvpacket),0); + state.recvpacketlen := twsocket(sender).Receive(@state.recvpacket, SizeOf(state.recvpacket)); + state.parsepacket := true; + asyncprocess; +end; + +function tdnsasync.sendquery; +begin +{ writeln('sendquery ',decodename(state.packet,state.packetlen,12,0,a),' ',state.requesttype);} + result := false; + if len = 0 then exit; {no packet} + if not sockopen then begin + if addr <> '' then sock.addr := addr else sock.addr := getcurrentsystemnameserver(dnsserverid);//getunixnameservercached; + startts := unixtimefloat; + if port = '' then port := '53'; + sock.port := port; + sock.Proto := 'udp'; + sock.ondataavailable := receivehandler; + try + sock.connect; + except + on e:exception do begin + //writeln('exception '+e.message); + exit; + end; + end; + sockopen := true; + end; + sock.send(@packet,len); + result := true; +end; + +procedure tdnsasync.asyncprocess; +begin + state_process(state); + case state.resultaction of + action_ignore: begin {do nothing} end; + action_done: begin + onrequestdone(self,0); + end; + action_sendquery:begin + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; +end; + +procedure tdnsasync.forwardlookup; +begin + {$ifdef win32} + if usewindns or (addr = '') then begin + dwas := tdnswinasync.create; + dwas.onrequestdone := winrequestdone; + if forwardfamily = AF_INET6 then begin + dwas.forwardlookup(name,true); + end else begin + dwas.forwardlookup(name,false); + end; + end; + {$endif} + + ipstrtobin(name,state.resultbin); + if state.resultbin.family <> 0 then begin + onrequestdone(self,0); + exit; + end; + + + setstate_forward(name,state,forwardfamily); + asyncprocess; + +end; + +procedure tdnsasync.reverselookup; + +begin + {$ifdef win32} + if usewindns or (addr = '') then begin + dwas := tdnswinasync.create; + dwas.onrequestdone := winrequestdone; + dwas.reverselookup(binip); + end; + {$endif} + + setstate_reverse(binip,state); + asyncprocess; +end; + +function tdnsasync.dnsresult; +begin + if state.resultstr <> '' then result := state.resultstr else begin + result := ipbintostr(state.resultbin); + end; +end; + +procedure tdnsasync.dnsresultbin(var binip:tbinip); +begin + move(state.resultbin,binip,sizeof(binip)); +end; + +procedure tdnsasync.cancel; +begin + {$ifdef win32} + if assigned(dwas) then begin + dwas.release; + dwas := nil; + end else + {$endif} + begin + + if dnsserverid >= 0 then begin + reportlag(dnsserverid,-1); + dnsserverid := -1; + end; + if sockopen then begin + sock.close; + sockopen := false; + end; + end; + setstate_failure(state); + onrequestdone(self,0); +end; + +{$ifdef win32} + procedure tdnsasync.winrequestdone(sender:tobject;error:word); + begin + if dwas.reverse then begin + state.resultstr := dwas.name; + end else begin + state.resultbin := dwas.ip; + if (forwardfamily = AF_INET6) and (state.resultbin.family = AF_INET) then begin + fillchar(state.resultbin,sizeof(tbinip),0); + end; + end; + dwas.release; + onrequestdone(self,error); + end; +{$endif} +end. diff --git a/httpserver_20080306/dnscore.pas b/httpserver_20080306/dnscore.pas new file mode 100755 index 0000000..bb4fab4 --- /dev/null +++ b/httpserver_20080306/dnscore.pas @@ -0,0 +1,728 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{ + + code wanting to use this dns system should act as follows (note: app + developers will probablly want to use dnsasync or dnssync or write a similar + wrapper unit of thier own). + + for normal lookups call setstate_forward or setstate_reverse to set up the + state, for more obscure lookups use setstate_request_init and fill in other + relavent state manually. + + call state_process which will do processing on the information in the state + and return an action + action_ignore means that dnscore wants the code that calls it to go + back to waiting for packets + action_sendpacket means that dnscore wants the code that calls it to send + the packet in sendpacket/sendpacketlen and then start (or go back to) listening + for + action_done means the request has completed (either suceeded or failed) + + callers should resend the last packet they tried to send if they have not + been asked to send a new packet for more than some timeout value they choose. + + when a packet is received the application should put the packet in + recvbuf/recvbuflen , set state.parsepacket and call state_process again + + once the app gets action_done it can determine sucess or failure in the + following ways. + + on failure state.resultstr will be an empty string and state.resultbin will + be zeroed out (easilly detected by the fact that it will have a family of 0) + + on success for a A or AAAA lookup state.resultstr will be an empty string + and state.resultbin will contain the result (note: AAAA lookups require IPV6 + enabled). + + if an A lookup fails and the code is built with ipv6 enabled then the code + will return any AAAA records with the same name. The reverse does not apply + so if an application preffers IPV6 but wants IPV4 results as well it must + check them seperately. + + on success for any other type of lookup state.resultstr will be an empty + + note the state contains ansistrings, setstate_init with a null name parameter + can be used to clean theese up if required. + + callers may use setstate_failure to mark the state as failed themseleves + before passing it on to other code, for example this may be done in the event + of a timeout. +} +unit dnscore; + + + +{$ifdef fpc}{$mode delphi}{$endif} + + + + + +interface + +uses binipstuff,classes,pgtypes; + +var usewindns : boolean = {$ifdef win32}true{$else}false{$endif}; +//hint to users of this unit that they should use windows dns instead. +//May be disabled by applications if desired. (e.g. if setting a custom +//dnsserverlist). + +//note: this unit will not be able to self populate it's dns server list on +//older versions of windows. + +const + maxnamelength=127; + maxnamefieldlen=63; + //note: when using action_ignore the dnscore code *must* preserve the contents of state.sendpacket to allow for retries + //note: action_ignore must not be used in response to the original request but there is no valid reason for doing this anyway + action_ignore=0; + action_done=1; + action_sendquery=2; + querytype_a=1; + querytype_cname=5; + querytype_aaaa=28; + querytype_ptr=12; + querytype_ns=2; + querytype_soa=6; + querytype_mx=15; + + maxrecursion=10; + maxrrofakind=20; + + retryafter=300000; //microseconds must be less than one second; + timeoutlag=1000000000; // penalty value to be treated as lag in the event of a timeout (microseconds) +type + dvar=array[0..0] of byte; + pdvar=^dvar; + tdnspacket=packed record + id:word; + flags:word; + rrcount:array[0..3] of word; + payload:array[0..511-12] of byte; + end; + + + + tdnsstate=record + id:word; + recursioncount:integer; + queryname:string; + requesttype:word; + parsepacket:boolean; + resultstr:string; + resultbin:tbinip; + resultaction:integer; + numrr1:array[0..3] of integer; + numrr2:integer; + rrdata:string; + sendpacketlen:integer; + sendpacket:tdnspacket; + recvpacketlen:integer; + recvpacket:tdnspacket; + forwardfamily:integer; + end; + + trr=packed record + requesttypehi:byte; + requesttype:byte; + clas:word; + ttl:integer; + datalen:word; + data:array[0..511] of byte; + end; + + trrpointer=packed record + p:pointer; + ofs:integer; + len:integer; + namelen:integer; + end; + +//commenting out functions from interface that do not have documented semantics +//and probablly should not be called from outside this unit, reenable them +//if you must but please document them at the same time --plugwash + +//function buildrequest(const name:string;var packet:tdnspacket;requesttype:word):integer; +//function makereversename(const binip:tbinip):string; + +procedure setstate_request_init(const name:string;var state:tdnsstate); + +//set up state for a foward lookup. A family value of AF_INET6 will give only +//ipv6 results. Any other value will give ipv4 results in preference and ipv6 +//results if ipv4 results are not available; +procedure setstate_forward(const name:string;var state:tdnsstate;family:integer); + +procedure setstate_reverse(const binip:tbinip;var state:tdnsstate); +procedure setstate_failure(var state:tdnsstate); +//procedure setstate_return(const rrp:trrpointer;len:integer;var state:tdnsstate); + + +procedure state_process(var state:tdnsstate); + +//function decodename(const packet:tdnspacket;len,start,recursion:integer;var numread:integer):string; + +//presumablly this is exported to allow more secure random functions +//to be substituted? +var randomfunction:function:integer; + + +procedure populatednsserverlist; +procedure cleardnsservercache; + +var + dnsserverlist : tstringlist; +// currentdnsserverno : integer; + +function getcurrentsystemnameserver(var id:integer) :string; + +//var +// unixnameservercache:string; +{ $endif} + + +procedure reportlag(id:integer;lag:integer); //lag should be in microseconds and should be -1 to report a timeout +var + failurereason:string; + +implementation + +uses + {$ifdef win32} + windows, + {$endif} + + sysutils; + +function buildrequest(const name:string;var packet:tdnspacket;requesttype:word):integer; +var + a,b:integer; + s:string; + arr:array[0..sizeof(packet)-1] of byte absolute packet; +begin + { writeln('buildrequest: name: ',name);} + result := 0; + fillchar(packet,sizeof(packet),0); + if assigned(randomfunction) then packet.id := (randomfunction and $ffff) else packet.id := random(65536); + packet.flags := htons($0100); + packet.rrcount[0] := htons($0001); + + + s := copy(name,1,maxnamelength); + if s = '' then exit; + if s[length(s)] <> '.' then s := s + '.'; + b := 0; + {encode name} + if (s = '.') then begin + packet.payload[0] := 0; + result := 12+5; + end else begin + for a := 1 to length(s) do begin + if s[a] = '.' then begin + if b > maxnamefieldlen then exit; + if (b = 0) then exit; + packet.payload[a-b-1] := b; + b := 0; + end else begin + packet.payload[a] := byte(s[a]); + inc(b); + end; + end; + if b > maxnamefieldlen then exit; + packet.payload[length(s)-b] := b; + result := length(s) + 12+5; + end; + + arr[result-1] := 1; + arr[result-3] := requesttype and $ff; + arr[result-4] := requesttype shr 8; +end; + +function makereversename(const binip:tbinip):string; +var + name:string; + a,b:integer; +begin + name := ''; + if binip.family = AF_INET then begin + b := htonl(binip.ip); + for a := 0 to 3 do begin + name := name + inttostr(b shr (a shl 3) and $ff)+'.'; + end; + name := name + 'in-addr.arpa'; + end else + {$ifdef ipv6} + if binip.family = AF_INET6 then begin + for a := 15 downto 0 do begin + b := binip.ip6.u6_addr8[a]; + name := name + hexchars[b and $f]+'.'+hexchars[b shr 4]+'.'; + end; + name := name + 'ip6.arpa'; + end else + {$endif} + begin + {empty name} + end; + result := name; +end; + +{ +decodes DNS format name to a string. does not includes the root dot. +doesnt read beyond len. +empty result + non null failurereason: failure +empty result + null failurereason: internal use +} +function decodename(const packet:tdnspacket;len,start,recursion:integer;var numread:integer):string; +var + arr:array[0..sizeof(packet)-1] of byte absolute packet; + s:string; + a,b:integer; +begin + numread := 0; + repeat + if (start+numread < 0) or (start+numread >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range1'; + exit; + end; + b := arr[start+numread]; + if b >= $c0 then begin + {recursive sub call} + if recursion > 10 then begin + result := ''; + failurereason := 'decoding name: max recursion'; + exit; + end; + if ((start+numread+1) >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range3'; + exit; + end; + a := ((b shl 8) or arr[start+numread+1]) and $3fff; + s := decodename(packet,len,a,recursion+1,a); + if (s = '') and (failurereason <> '') then begin + result := ''; + exit; + end; + if result <> '' then result := result + '.'; + result := result + s; + inc(numread,2); + exit; + end else if b < 64 then begin + if (numread <> 0) and (b <> 0) then result := result + '.'; + for a := start+numread+1 to start+numread+b do begin + if (a >= len) then begin + result := ''; + failurereason := 'decoding name: got out of range2'; + exit; + end; + result := result + char(arr[a]); + end; + inc(numread,b+1); + + if b = 0 then begin + if (result = '') and (recursion = 0) then result := '.'; + exit; {reached end of name} + end; + end else begin + failurereason := 'decoding name: read invalid char'; + result := ''; + exit; {invalid} + end; + until false; +end; + +{==============================================================================} + +procedure setstate_return(const rrp:trrpointer;len:integer;var state:tdnsstate); +var + a:integer; +begin + state.resultaction := action_done; + state.resultstr := ''; + case trr(rrp.p^).requesttype of + querytype_a: begin + if htons(trr(rrp.p^).datalen) <> 4 then exit; + move(trr(rrp.p^).data,state.resultbin.ip,4); + state.resultbin.family :=AF_INET; + end; + {$ifdef ipv6} + querytype_aaaa: begin + if htons(trr(rrp.p^).datalen) <> 16 then exit; + state.resultbin.family := AF_INET6; + move(trr(rrp.p^).data,state.resultbin.ip6,16); + end; + {$endif} + else + {other reply types (PTR, MX) return a hostname} + state.resultstr := decodename(state.recvpacket,state.recvpacketlen,taddrint(rrp.p)-taddrint(@state.recvpacket)+10,0,a); + fillchar(state.resultbin,sizeof(state.resultbin),0); + end; +end; + +procedure setstate_request_init(const name:string;var state:tdnsstate); +begin + {destroy things properly} + state.resultstr := ''; + state.queryname := ''; + state.rrdata := ''; + fillchar(state,sizeof(state),0); + state.queryname := name; + state.parsepacket := false; +end; + +procedure setstate_forward(const name:string;var state:tdnsstate;family:integer); +begin + setstate_request_init(name,state); + state.forwardfamily := family; + {$ifdef ipv6} + if family = AF_INET6 then state.requesttype := querytype_aaaa else + {$endif} + state.requesttype := querytype_a; +end; + +procedure setstate_reverse(const binip:tbinip;var state:tdnsstate); +begin + setstate_request_init(makereversename(binip),state); + state.requesttype := querytype_ptr; +end; + +procedure setstate_failure(var state:tdnsstate); +begin + state.resultstr := ''; + fillchar(state.resultbin,sizeof(state.resultbin),0); + state.resultaction := action_done; +end; + +procedure state_process(var state:tdnsstate); +label recursed; +label failure; +var + a,b,ofs:integer; + rrtemp:^trr; + rrptemp:^trrpointer; +begin + if state.parsepacket then begin + if state.recvpacketlen < 12 then begin + failurereason := 'Undersized packet'; + state.resultaction := action_ignore; + exit; + end; + if state.id <> state.recvpacket.id then begin + failurereason := 'ID mismatch'; + state.resultaction := action_ignore; + exit; + end; + state.numrr2 := 0; + for a := 0 to 3 do begin + state.numrr1[a] := htons(state.recvpacket.rrcount[a]); + if state.numrr1[a] > maxrrofakind then goto failure; + inc(state.numrr2,state.numrr1[a]); + end; + + setlength(state.rrdata,state.numrr2*sizeof(trrpointer)); + + {- put all replies into a list} + + ofs := 12; + {get all queries} + for a := 0 to state.numrr1[0]-1 do begin + if (ofs < 12) or (ofs > state.recvpacketlen-4) then goto failure; + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrptemp.p := @state.recvpacket.payload[ofs-12]; + rrptemp.ofs := ofs; + decodename(state.recvpacket,state.recvpacketlen,ofs,0,b); + rrptemp.len := b + 4; + inc(ofs,rrptemp.len); + end; + + for a := state.numrr1[0] to state.numrr2-1 do begin + if (ofs < 12) or (ofs > state.recvpacketlen-12) then goto failure; + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + if decodename(state.recvpacket,state.recvpacketlen,ofs,0,b) = '' then goto failure; + rrtemp := @state.recvpacket.payload[ofs-12+b]; {rrtemp points to values and result, after initial name} + rrptemp.p := rrtemp; + rrptemp.ofs := ofs; {ofs is start of RR before initial name from start of packet} + rrptemp.namelen := b; + b := htons(rrtemp.datalen); + rrptemp.len := b + 10 + rrptemp.namelen; + inc(ofs,rrptemp.len); + end; + if (ofs <> state.recvpacketlen) then begin + failurereason := 'ofs <> state.packetlen'; + goto failure; + end; + + {- check for items of the requested type in answer section, if so return success first} + for a := state.numrr1[0] to (state.numrr1[0]+state.numrr1[1]-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = state.requesttype then begin + setstate_return(rrptemp^,b,state); + exit; + end; + end; + + {if no items of correct type found, follow first cname in answer section} + for a := state.numrr1[0] to (state.numrr1[0]+state.numrr1[1]-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = querytype_cname then begin + state.queryname := decodename(state.recvpacket,state.recvpacketlen,rrptemp.ofs+12,0,b); + goto recursed; + end; + end; + + {no cnames found, no items of correct type found} + if state.forwardfamily <> 0 then goto failure; +{$ifdef ipv6} + if (state.requesttype = querytype_a) then begin + {v6 only: in case of forward, look for AAAA in alternative section} + for a := state.numrr1[0]+state.numrr1[1]+state.numrr1[2] to (state.numrr2-1) do begin + rrptemp := @state.rrdata[1+a*sizeof(trrpointer)]; + rrtemp := rrptemp.p; + b := rrptemp.len; + if rrtemp.requesttype = querytype_aaaa then begin + setstate_return(rrptemp^,b,state); + exit; + end; + end; + {no AAAA's found in alternative, do a recursive lookup for them} + state.requesttype := querytype_aaaa; + goto recursed; + end; +{$endif} + goto failure; +recursed: + {here it needs recursed lookup} + {if needing to follow a cname, change state to do so} + inc(state.recursioncount); + if state.recursioncount > maxrecursion then goto failure; + end; + + {here, a name needs to be resolved} + if state.queryname = '' then begin + failurereason := 'empty query name'; + goto failure; + end; + + {do /ets/hosts lookup here} + state.sendpacketlen := buildrequest(state.queryname,state.sendpacket,state.requesttype); + if state.sendpacketlen = 0 then begin + failurereason := 'building request packet failed'; + goto failure; + end; + state.id := state.sendpacket.id; + state.resultaction := action_sendquery; + + exit; +failure: + setstate_failure(state); +end; +{$ifdef win32} + const + MAX_HOSTNAME_LEN = 132; + MAX_DOMAIN_NAME_LEN = 132; + MAX_SCOPE_ID_LEN = 260 ; + MAX_ADAPTER_NAME_LENGTH = 260; + MAX_ADAPTER_ADDRESS_LENGTH = 8; + MAX_ADAPTER_DESCRIPTION_LENGTH = 132; + ERROR_BUFFER_OVERFLOW = 111; + MIB_IF_TYPE_ETHERNET = 6; + MIB_IF_TYPE_TOKENRING = 9; + MIB_IF_TYPE_FDDI = 15; + MIB_IF_TYPE_PPP = 23; + MIB_IF_TYPE_LOOPBACK = 24; + MIB_IF_TYPE_SLIP = 28; + + + type + tip_addr_string=packed record + Next :pointer; + IpAddress : array[0..15] of char; + ipmask : array[0..15] of char; + context : dword; + end; + pip_addr_string=^tip_addr_string; + tFIXED_INFO=packed record + HostName : array[0..MAX_HOSTNAME_LEN-1] of char; + DomainName : array[0..MAX_DOMAIN_NAME_LEN-1] of char; + currentdnsserver : pip_addr_string; + dnsserverlist : tip_addr_string; + nodetype : longint; + ScopeId : array[0..MAX_SCOPE_ID_LEN + 4] of char; + enablerouting : longbool; + enableproxy : longbool; + enabledns : longbool; + end; + pFIXED_INFO=^tFIXED_INFO; + + var + iphlpapi : thandle; + getnetworkparams : function(pFixedInfo : PFIXED_INFO;OutBufLen : plongint) : longint;stdcall; +{$endif} +procedure populatednsserverlist; +var + {$ifdef win32} + fixed_info : pfixed_info; + fixed_info_len : longint; + currentdnsserver : pip_addr_string; + {$else} + t:textfile; + s:string; + a:integer; + {$endif} +begin + //result := ''; + if assigned(dnsserverlist) then begin + dnsserverlist.clear; + end else begin + dnsserverlist := tstringlist.Create; + end; + {$ifdef win32} + if iphlpapi=0 then iphlpapi := loadlibrary('iphlpapi.dll'); + if not assigned(getnetworkparams) then @getnetworkparams := getprocaddress(iphlpapi,'GetNetworkParams'); + fixed_info_len := 0; + if GetNetworkParams(nil,@fixed_info_len)<>ERROR_BUFFER_OVERFLOW then exit; + //fixed_info_len :=sizeof(tfixed_info); + getmem(fixed_info,fixed_info_len); + if GetNetworkParams(fixed_info,@fixed_info_len)<>0 then begin + freemem(fixed_info); + exit; + end; + currentdnsserver := @(fixed_info.dnsserverlist); + while assigned(currentdnsserver) do begin + dnsserverlist.Add(currentdnsserver.IpAddress); + currentdnsserver := currentdnsserver.next; + end; + freemem(fixed_info); + {$else} + filemode := 0; + assignfile(t,'/etc/resolv.conf'); + {$i-}reset(t);{$i+} + if ioresult <> 0 then exit; + + while not eof(t) do begin + readln(t,s); + if not (copy(s,1,10) = 'nameserver') then continue; + s := copy(s,11,500); + while s <> '' do begin + if (s[1] = #32) or (s[1] = #9) then s := copy(s,2,500) else break; + end; + a := pos(' ',s); + if a <> 0 then s := copy(s,1,a-1); + a := pos(#9,s); + if a <> 0 then s := copy(s,1,a-1); + //result := s; + //if result <> '' then break; + dnsserverlist.Add(s); + end; + close(t); + {$endif} +end; + +procedure cleardnsservercache; +begin + if assigned(dnsserverlist) then begin + dnsserverlist.destroy; + dnsserverlist := nil; + end; +end; + +function getcurrentsystemnameserver(var id:integer):string; +var + counter : integer; + +begin + if not assigned(dnsserverlist) then populatednsserverlist; + if dnsserverlist.count=0 then raise exception.create('no dns servers availible'); + id := 0; + if dnsserverlist.count >1 then begin + + for counter := 1 to dnsserverlist.count-1 do begin + if taddrint(dnsserverlist.objects[counter]) < taddrint(dnsserverlist.objects[id]) then id := counter; + end; + end; + result := dnsserverlist[id] +end; + +procedure reportlag(id:integer;lag:integer); //lag should be in microseconds and should be -1 to report a timeout +var + counter : integer; + temp : integer; +begin + if (id < 0) or (id >= dnsserverlist.count) then exit; + if lag = -1 then lag := timeoutlag; + for counter := 0 to dnsserverlist.count-1 do begin + temp := taddrint(dnsserverlist.objects[counter]) *15; + if counter=id then temp := temp + lag; + dnsserverlist.objects[counter] := tobject(temp div 16); + end; + +end; + +{ quick and dirty description of dns packet structure to aid writing and + understanding of parser code, refer to appropriate RFCs for proper specs +- all words are network order + +www.google.com A request: + +0, 2: random transaction ID +2, 2: flags: only the "recursion desired" bit set. (bit 8 of word) +4, 2: questions: 1 +6, 2: answer RR's: 0. +8, 2: authority RR's: 0. +10, 2: additional RR's: 0. +12, n: payload: + query: + #03 "www" #06 "google" #03 "com" #00 + size-4, 2: type: host address (1) + size-2, 2: class: inet (1) + +reply: + +0,2: random transaction ID +2,2: flags: set: response (bit 15), recursion desired (8), recursion available (7) +4,4: questions: 1 +6,4: answer RR's: 2 +8,4: authority RR's: 9 +10,4: additional RR's: 9 +12: payload: + query: + .... + answer: CNAME + 0,2 "c0 0c" "name: www.google.com" + 2,2 "00 05" "type: cname for an alias" + 4,2 "00 01" "class: inet" + 6,4: TTL + 10,2: data length "00 17" (23) + 12: the cname name (www.google.akadns.net) + answer: A + 0,2 .. + 2,2 "00 01" host address + 4,2 ... + 6,4 ... + 10,2: data length (4) + 12,4: binary IP + authority - 9 records + additional - 9 records + + + ipv6 AAAA reply: + 0,2: ... + 2,2: type: 001c + 4,2: class: inet (0001) + 6,2: TTL + 10,2: data size (16) + 12,16: binary IP + + ptr request: query type 000c + +name compression: word "cxxx" in the name, xxx points to offset in the packet} + +end. diff --git a/httpserver_20080306/dnssync.pas b/httpserver_20080306/dnssync.pas new file mode 100755 index 0000000..c64d320 --- /dev/null +++ b/httpserver_20080306/dnssync.pas @@ -0,0 +1,262 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +unit dnssync; +{$ifdef fpc} + {$mode delphi} +{$endif} + +interface + uses + dnscore, + binipstuff, + {$ifdef win32} + winsock, + windows, + {$else} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix, + {$endif} + sockets, + fd_utils, + {$endif} + sysutils; + +//convert a name to an IP +//IPV4 is preffered if availible, if not IPV6 will be returned (if ipv6 support +//compiled in) +//on error the binip will have a family of 0 (other fiels are also currently +//zeroed out but may be used for further error information in future) +//timeout is in seconds, it is ignored when using windows dns +function forwardlookup(name:string;timeout:integer):tbinip; + + +//convert an IP to a name, on error a null string will be returned, other +//details as above +function reverselookup(ip:tbinip;timeout:integer):string; + + +var + dnssyncserver:string; + id : integer; + {$ifdef win32} + sendquerytime : integer; + {$else} + sendquerytime : ttimeval; + {$endif} +implementation +{$ifdef win32} + uses dnswin; +{$endif} + +{$i unixstuff.inc} +{$i ltimevalstuff.inc} + +var + fd:integer; + state:tdnsstate; +{$ifdef win32} + const + winsocket = 'wsock32.dll'; + function sendto(s: TSocket; const Buf; len, flags: Integer; var addrto: TinetSockAddr; tolen: Integer): Integer; stdcall; external winsocket name 'sendto'; + function bind(s: TSocket; var addr: TinetSockAddr; namelen: Integer): Longbool; stdcall; external winsocket name 'bind'; + type + fdset=tfdset; +{$endif} + +function sendquery(const packet:tdnspacket;len:integer):boolean; +var + a:integer; + addr : string; + port : string; + inaddr : TInetSockAddr; + +begin +{ writeln('sendquery ',decodename(state.packet,state.packetlen,12,0,a),' ',state.requesttype);} + result := false; + if len = 0 then exit; {no packet} + + if dnssyncserver <> '' then addr := dnssyncserver else addr := getcurrentsystemnameserver(id); + port := '53'; + + inAddr.family:=AF_INET; + inAddr.port:=htons(strtointdef(port,0)); + inAddr.addr:=htonl(longip(addr)); + + sendto(fd,packet,len,0,inaddr,sizeof(inaddr)); + {$ifdef win32} + sendquerytime := GetTickCount and $3fff; + {$else} + gettimeofday(sendquerytime); + {$endif} + result := true; +end; + +procedure setupsocket; +var + inAddrtemp : TInetSockAddr; +begin + if fd > 0 then exit; + + fd := Socket(AF_INET,SOCK_DGRAM,0); + inAddrtemp.family:=AF_INET; + inAddrtemp.port:=0; + inAddrtemp.addr:=0;{htonl(longip('0.0.0.0'));} + If {$ifndef win32}Not{$endif} Bind(fd,inAddrtemp,SizeOf(inAddrtemp)) Then begin + {$ifdef win32} + raise Exception.create('unable to bind '+inttostr(WSAGetLastError)); + {$else} + raise Exception.create('unable to bind '+inttostr(socketError)); + {$endif} + end; +end; + +procedure resolveloop(timeout:integer); +var + selectresult : integer; + fds : fdset; + {$ifdef win32} + endtime : longint; + starttime : longint; + wrapmode : boolean; + currenttime : integer; + {$else} + endtime : ttimeval; + currenttime : ttimeval; + + {$endif} + lag : ttimeval; + currenttimeout : ttimeval; + selecttimeout : ttimeval; + + +begin + {$ifdef win32} + starttime := GetTickCount and $3fff; + endtime := starttime +(timeout*1000); + if (endtime and $4000)=0 then begin + wrapmode := false; + end else begin + wrapmode := true; + end; + endtime := endtime and $3fff; + {$else} + gettimeofday(endtime); + endtime.tv_sec := endtime.tv_sec + timeout; + {$endif} + + setupsocket; + repeat + state_process(state); + case state.resultaction of + action_ignore: begin +{ writeln('ignore');} + {do nothing} + end; + action_done: begin +{ writeln('done');} + exit; + //onrequestdone(self,0); + end; + action_sendquery:begin +{ writeln('send query');} + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; + {$ifdef win32} + currenttime := GetTickCount and $3fff; + msectotimeval(selecttimeout, (endtime-currenttime)and$3fff); + {$else} + gettimeofday(currenttime); + selecttimeout := endtime; + tv_substract(selecttimeout,currenttime); + {$endif} + fd_zero(fds); + fd_set(fd,fds); + if (selecttimeout.tv_sec > 0) or (selecttimeout.tv_usec > retryafter) then begin + selecttimeout.tv_sec := 0; + selecttimeout.tv_usec := retryafter; + end; + selectresult := select(fd+1,@fds,nil,nil,@selecttimeout); + if selectresult > 0 then begin +{ writeln('selectresult>0');} + //why the hell are we zeroing out the packet buffer before reading into it?! --plugwash + fillchar(state.recvpacket,sizeof(state.recvpacket),0); + {$ifdef win32} + msectotimeval(lag,(currenttime-sendquerytime)and$3fff); + {$else} + lag := currenttime; + tv_substract(lag,sendquerytime); + + {$endif} + + reportlag(id,(lag.tv_sec*1000000)+lag.tv_usec); + state.recvpacketlen := recv(fd,state.recvpacket, SizeOf(state.recvpacket),0); + state.parsepacket := true; + end; + if selectresult < 0 then exit; + if selectresult = 0 then begin + {$ifdef win32} + currenttime := GetTickCount; + {$else} + gettimeofday(currenttime); + {$endif} + reportlag(id,-1); + if {$ifdef win32}(currenttime >= endtime)and ((not wrapmode) or (currenttime < starttime)) {$else}tv_compare(currenttime,endtime){$endif} {currenttime >= endtime } then begin + exit; + end else begin + //resend + sendquery(state.sendpacket,state.sendpacketlen); + end; + end; + until false; +end; + +function forwardlookup(name:string;timeout:integer):tbinip; +var + dummy : integer; +begin + ipstrtobin(name,result); + if result.family <> 0 then exit; //it was an IP address, no need for dns + //lookup + {$ifdef win32} + if usewindns then begin + result := winforwardlookup(name,false,dummy); + exit; + end; + {$endif} + setstate_forward(name,state,0); + resolveloop(timeout); + result := state.resultbin; +end; + +function reverselookup(ip:tbinip;timeout:integer):string; +var + dummy : integer; +begin + {$ifdef win32} + if usewindns then begin + result := winreverselookup(ip,dummy); + exit; + end; + {$endif} + setstate_reverse(ip,state); + resolveloop(timeout); + result := state.resultstr; +end; + +{$ifdef win32} + var + wsadata : twsadata; + + initialization + WSAStartUp($2,wsadata); + finalization + WSACleanUp; +{$endif} +end. + + diff --git a/httpserver_20080306/dnswin.pas b/httpserver_20080306/dnswin.pas new file mode 100755 index 0000000..bae0780 --- /dev/null +++ b/httpserver_20080306/dnswin.pas @@ -0,0 +1,332 @@ +unit dnswin; + +interface +uses binipstuff,classes,lcore; + +//on failure a null string or zeroed out binip will be retuned and error will be +//set to a windows error code (error will be left untouched under non error +//conditions). +function winforwardlookup(name : string;ipv6preffered : boolean;var error:integer) : tbinip; +function winreverselookup(ip:tbinip;var error:integer):string; + + +type + //do not call destroy on a tdnswinasync instead call release and the + //dnswinasync will be freed when appropriate. Calling destroy will block + //the calling thread until the dns lookup completes. + //release should only be called from the main thread + tdnswinasync=class(tthread) + private + ipv6preffered : boolean; + freverse : boolean; + error : integer; + freewhendone : boolean; + hadevent : boolean; + protected + procedure execute; override; + public + onrequestdone:tsocketevent; + name : string; + ip : tbinip; + + procedure forwardlookup(name:string;ipv6preffered:boolean); + procedure reverselookup(ip:tbinip); + destructor destroy; override; + procedure release; + constructor create; + property reverse : boolean read freverse; + + end; + +implementation +uses + lsocket,pgtypes,sysutils,winsock,windows,messages; + +type + //taddrinfo = record; //forward declaration + paddrinfo = ^taddrinfo; + taddrinfo = packed record + ai_flags : longint; + ai_family : longint; + ai_socktype : longint; + ai_protocol : longint; + ai_addrlen : taddrint; + ai_canonname : pchar; + ai_addr : pinetsockaddrv; + ai_next : paddrinfo; + end; + ppaddrinfo = ^paddrinfo; + tgetaddrinfo = function(nodename : pchar; servname : pchar; hints : paddrinfo;res : ppaddrinfo) : longint; stdcall; + tfreeaddrinfo = procedure(ai : paddrinfo); stdcall; + tgetnameinfo = function(sa:Pinetsockaddrv;salen : longint; host:pchar;hostlen : longint;serv:pchar;servlen:longint;flags:longint) : longint;stdcall; +var + getaddrinfo : tgetaddrinfo; + freeaddrinfo : tfreeaddrinfo; + getnameinfo : tgetnameinfo; +procedure v4onlyfreeaddrinfo(ai : paddrinfo); stdcall; +begin + freemem(ai.ai_addr); + freemem(ai); +end; + +type + plongint = ^longint; + pplongint = ^plongint; + +function v4onlygetaddrinfo(nodename : pchar; servname : pchar; hints : paddrinfo;res : ppaddrinfo) : longint; stdcall; +var + output : paddrinfo; + hostent : phostent; +begin + if hints.ai_family = af_inet then begin + result := 0; + getmem(output,sizeof(taddrinfo)); + getmem(output.ai_addr,sizeof(tinetsockaddr)); + output.ai_addr.InAddr.family := af_inet; + if servname <> nil then output.ai_addr.InAddr.port := htons(strtoint(servname)) else output.ai_addr.InAddr.port := 0; + hostent := gethostbyname(nodename); + if hostent = nil then begin + result := wsagetlasterror; + v4onlyfreeaddrinfo(output); + exit; + end; + output.ai_addr.InAddr.addr := pplongint(hostent.h_addr_list)^^; + output.ai_flags := 0; + output.ai_family := af_inet; + output.ai_socktype := 0; + output.ai_protocol := 0; + output.ai_addrlen := sizeof(tinetsockaddr); + output.ai_canonname := nil; + output.ai_next := nil; + + res^ := output; + end else begin + result := WSANO_RECOVERY; + end; +end; + +function min(a,b : integer):integer; +begin + if a 0 then begin + fillchar(result,0,sizeof(result)); + error := getaddrinforesult; + end; +end; + +function winreverselookup(ip:tbinip;var error : integer):string; +var + sa : tinetsockaddrv; + getnameinforesult : integer; +begin + + if ip.family = AF_INET then begin + sa.InAddr.family := AF_INET; + sa.InAddr.port := 1; + sa.InAddr.addr := ip.ip; + end else if ip.family = AF_INET6 then begin + sa.InAddr6.sin6_family := AF_INET6; + sa.InAddr6.sin6_port := 1; + sa.InAddr6.sin6_addr := ip.ip6; + end else begin + raise exception.create('unrecognised address family'); + end; + populateprocvars; + setlength(result,1025); + getnameinforesult := getnameinfo(@sa,sizeof(tinetsockaddrv),pchar(result),length(result),nil,0,0); + if getnameinforesult <> 0 then begin + error := getnameinforesult; + result := ''; + exit; + end; + if pos(#0,result) >= 0 then begin + setlength(result,pos(#0,result)-1); + end; +end; + +var + hwnddnswin : hwnd; + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + dwas : tdnswinasync; +begin + if (ahwnd=hwnddnswin) and (aumsg=wm_user) then begin + Dwas := tdnswinasync(alparam); + dwas.hadevent := true; + if assigned (dwas.onrequestdone) then dwas.onrequestdone(dwas,awparam); + if dwas.freewhendone then dwas.free; + end else begin + //not passing unknown messages on to defwindowproc will cause window + //creation to fail! --plugwash + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; +end; + +procedure tdnswinasync.forwardlookup(name:string;ipv6preffered:boolean); +begin + self.name := name; + self.ipv6preffered := ipv6preffered; + freverse := false; + resume; +end; +procedure tdnswinasync.reverselookup(ip:tbinip); +begin + self.ip := ip; + freverse := true; + resume; +end; +procedure tdnswinasync.execute; +var + error : integer; +begin + error := 0; + if reverse then begin + name := winreverselookup(ip,error); + end else begin + ip := winforwardlookup(name,ipv6preffered,error); + + end; + + postmessage(hwnddnswin,wm_user,error,taddrint(self)); +end; + +destructor tdnswinasync.destroy; +begin + WaitFor; + inherited destroy; +end; +procedure tdnswinasync.release; +begin + if hadevent then destroy else begin + onrequestdone := nil; + freewhendone := true; + end; +end; + +constructor tdnswinasync.create; +begin + inherited create(true); +end; + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'dnswinClass'); +begin + + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create lcore handle, hinstance=',hinstance); + hwnddnswin := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + //writeln('dnswin hwnd is ',hwnddnswin); + //writeln('last error is ',GetLastError); +end. diff --git a/httpserver_20080306/fd_utils.pas b/httpserver_20080306/fd_utils.pas new file mode 100755 index 0000000..9ad93dd --- /dev/null +++ b/httpserver_20080306/fd_utils.pas @@ -0,0 +1,69 @@ +// this file contains code copied from linux.pp in the free pascal rtl +// i had to copy them because i use a different definition of fdset to them +// the copyright block from the file in question is shown below +{ + $Id: fd_utils.pas,v 1.2 2004/08/19 23:12:09 plugwash Exp $ + This file is part of the Free Pascal run time library. + Copyright (c) 1999-2000 by Michael Van Canneyt, + BSD parts (c) 2000 by Marco van de Voort + members of the Free Pascal development team. + + See the file COPYING.FPC, included in this distribution, + for details about the copyright. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY;without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. + +**********************************************************************} +{$ifdef fpc} + {$mode delphi} + {$inlining on} +{$endif} +unit fd_utils; +interface + +type + FDSet= Array [0..255] of longint; {31} + PFDSet= ^FDSet; +const + absoloutemaxs=(sizeof(fdset)*8)-1; + +Procedure FD_Clr(fd:longint;var fds:fdSet); +Procedure FD_Zero(var fds:fdSet); +Procedure FD_Set(fd:longint;var fds:fdSet); +Function FD_IsSet(fd:longint;var fds:fdSet):boolean; + + +implementation +uses sysutils; +Procedure FD_Clr(fd:longint;var fds:fdSet);{$ifdef fpc}inline;{$endif} +{ Remove fd from the set of filedescriptors} +begin + if (fd < 0) then raise exception.create('FD_Clr fd out of range: '+inttostr(fd)); + fds[fd shr 5]:=fds[fd shr 5] and (not (1 shl (fd and 31))); +end; + +Procedure FD_Zero(var fds:fdSet); +{ Clear the set of filedescriptors } +begin + FillChar(fds,sizeof(fdSet),0); +end; + +Procedure FD_Set(fd:longint;var fds:fdSet);{$ifdef fpc}inline;{$endif} +{ Add fd to the set of filedescriptors } +begin + if (fd < 0) then raise exception.create('FD_set fd out of range: '+inttostr(fd)); + fds[fd shr 5]:=fds[fd shr 5] or (1 shl (fd and 31)); +end; + +Function FD_IsSet(fd:longint;var fds:fdSet):boolean;{$ifdef fpc}inline;{$endif} +{ Test if fd is part of the set of filedescriptors } +begin + if (fd < 0) then begin + result := false; + exit; + end; + FD_IsSet:=((fds[fd shr 5] and (1 shl (fd and 31)))<>0); +end; +end. diff --git a/httpserver_20080306/lcore.pas b/httpserver_20080306/lcore.pas new file mode 100755 index 0000000..51fbf78 --- /dev/null +++ b/httpserver_20080306/lcore.pas @@ -0,0 +1,889 @@ +{lsocket.pas} + +{io and timer code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{note: you must use the @ in the last param to tltask.create not doing so will + compile without error but will cause an access violation -pg} + +//note: events after release are normal and are the apps responsibility to deal with safely + +unit lcore; +{$ifdef fpc} + {$mode delphi} +{$endif} +{$ifdef win32} + {$define nosignal} +{$endif} +interface + uses + sysutils, + {$ifndef win32} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix, + {$endif} + fd_utils, + {$endif} + classes,pgtypes,bfifo; + procedure processtasks; + + + + + + + + const + receivebufsize=1460; + + type + {$ifdef ver1_0} + sigset= array[0..31] of longint; + {$endif} + + ESocketException = class(Exception); + TBgExceptionEvent = procedure (Sender : TObject; + E : Exception; + var CanClose : Boolean) of object; + + // note : tsocketstate is defined in the same way as it is in François PIETTE's twsocket + // however tlsocket currently only uses wsClosed wsConnecting wsconnected and wsListening + TSocketState = (wsInvalidState, + wsOpened, wsBound, + wsConnecting, wsConnected, + wsAccepting, wsListening, + wsClosed); + + TWSocketOption = (wsoNoReceiveLoop, wsoTcpNoDelay); + TWSocketOptions = set of TWSocketOption; + + TSocketevent = procedure(Sender: TObject; Error: word) of object; + //Tdataavailevent = procedure(data : string); + TSendData = procedure (Sender: TObject; BytesSent: Integer) of object; + + tlcomponent = class(tcomponent) + public + released:boolean; + procedure release; virtual; + destructor destroy; override; + end; + + tlasio = class(tlcomponent) + public + state : tsocketstate ; + ComponentOptions : TWSocketOptions; + fdhandlein : Longint ; {file discriptor} + fdhandleout : Longint ; {file discriptor} + + onsessionclosed : tsocketevent ; + ondataAvailable : tsocketevent ; + onsessionAvailable : tsocketevent ; + + onsessionconnected : tsocketevent ; + onsenddata : tsenddata ; + ondatasent : tsocketevent ; + //connected : boolean ; + nextasin : tlasio ; + prevasin : tlasio ; + + recvq : tfifo; + OnBgException : TBgExceptionEvent ; + //connectread : boolean ; + sendq : tfifo; + closehandles : boolean ; + writtenthiscycle : boolean ; + onfdwrite : procedure (Sender: TObject; Error: word) of object; //added for bewarehttpd + lasterror:integer; + destroying:boolean; + function receivestr:string; virtual; + procedure close; + procedure abort; + procedure internalclose(error:word); virtual; + constructor Create(AOwner: TComponent); override; + + destructor destroy; override; + procedure fdcleanup; + procedure HandleBackGroundException(E: Exception); + procedure handlefdtrigger(readtrigger,writetrigger:boolean); virtual; + procedure dup(invalue:longint); + + function sendflush : integer; + procedure sendstr(const str : string);virtual; + procedure putstringinsendbuffer(const newstring : string); + function send(data:pointer;len:integer):integer;virtual; + procedure putdatainsendbuffer(data:pointer;len:integer); virtual; + procedure deletebuffereddata; + + //procedure messageloop; + function Receive(Buf:Pointer;BufSize:integer):integer; virtual; + procedure flush;virtual;{$ifdef win32} abstract;{$endif} + procedure dodatasent(wparam,lparam:longint); + procedure doreceiveloop(wparam,lparam:longint); + procedure sinkdata(sender:tobject;error:word); + + procedure release; override; {test -beware} + + function RealSend(Data : Pointer; Len : Integer) : Integer; //added for bewarehttpd + + procedure myfdclose(fd : integer); virtual;{$ifdef win32}abstract;{$endif} + function myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; virtual;{$ifdef win32}abstract;{$endif} + function myfdread(fd: LongInt;var buf;size: LongInt):LongInt; virtual;{$ifdef win32}abstract;{$endif} + protected + procedure dupnowatch(invalue:longint); + end; + ttimerwrapperinterface=class(tlcomponent) + public + function createwrappedtimer : tobject;virtual;abstract; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);virtual;abstract; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);virtual;abstract; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);virtual;abstract; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);virtual;abstract; + end; + + var + timerwrapperinterface : ttimerwrapperinterface; + type + {$ifdef win32} + ttimeval = record + tv_sec : longint; + tv_usec : longint; + end; + {$endif} + tltimer=class(tlcomponent) + protected + + + wrappedtimer : tobject; + + +// finitialevent : boolean ; + fontimer : tnotifyevent ; + fenabled : boolean ; + finterval : integer ; {miliseconds, default 1000} + {$ifndef win32} + procedure resettimes; + {$endif} +// procedure setinitialevent(newvalue : boolean); + procedure setontimer(newvalue:tnotifyevent); + procedure setenabled(newvalue : boolean); + procedure setinterval(newvalue : integer); + public + //making theese public for now, this code should probablly be restructured later though + prevtimer : tltimer ; + nexttimer : tltimer ; + nextts : ttimeval ; + + constructor create(aowner:tcomponent);override; + destructor destroy;override; +// property initialevent : boolean read finitialevent write setinitialevent; + property ontimer : tnotifyevent read fontimer write setontimer; + property enabled : boolean read fenabled write setenabled; + property interval : integer read finterval write setinterval; + + end; + + ttaskevent=procedure(wparam,lparam:longint) of object; + + tltask=class(tobject) + public + handler : ttaskevent; + obj : tobject; + wparam : longint; + lparam : longint; + nexttask : tltask; + constructor create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); + end; + + + + teventcore=class + public + procedure processmessages; virtual;abstract; + procedure messageloop; virtual;abstract; + procedure exitmessageloop; virtual;abstract; + procedure setfdreverse(fd : integer;reverseto : tlasio);virtual;abstract; + procedure rmasterset(fd : integer;islistensocket : boolean); virtual;abstract; + procedure rmasterclr(fd: integer); virtual;abstract; + procedure wmasterset(fd : integer); virtual;abstract; + procedure wmasterclr(fd: integer); virtual;abstract; + end; +var + eventcore : teventcore; + +procedure processmessages; +procedure messageloop; +procedure exitmessageloop; + +var + firstasin : tlasio ; + firsttimer : tltimer ; + firsttask , lasttask , currenttask : tltask ; + + numread : integer ; + mustrefreshfds : boolean ; +{ lcoretestcount:integer;} + + asinreleaseflag:boolean; + + +procedure disconnecttasks(aobj:tobject); +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +type + tonaddtask = procedure(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +var + onaddtask : tonaddtask; + + +procedure sleep(i:integer); +{$ifndef nosignal} + procedure prepsigpipe;inline; +{$endif} + + +implementation +{$ifndef nosignal} + uses {sockets,}lloopback,lsignal; +{$endif} +{$ifdef win32} + uses windows; +{$endif} +{$ifndef win32} + {$include unixstuff.inc} +{$endif} +{$include ltimevalstuff.inc} + + +{!!! added sleep call -beware} +procedure sleep(i:integer); +var + tv:ttimeval; +begin + {$ifdef win32} + windows.sleep(i); + {$else} + tv.tv_sec := i div 1000; + tv.tv_usec := (i mod 1000) * 1000; + select(0,nil,nil,nil,@tv); + {$endif} +end; + +destructor tlcomponent.destroy; +begin + disconnecttasks(self); + inherited destroy; +end; + + + + +procedure tlcomponent.release; +begin + released := true; +end; + +procedure tlasio.release; +begin + asinreleaseflag := true; + inherited release; +end; + +procedure tlasio.doreceiveloop; +begin + if recvq.size = 0 then exit; + if assigned(ondataavailable) then ondataavailable(self,0); + if not (wsonoreceiveloop in componentoptions) then + if recvq.size > 0 then tltask.create(self.doreceiveloop,self,0,0); +end; + +function tlasio.receivestr; +begin + setlength(result,recvq.size); + receive(@result[1],length(result)); +end; + +function tlasio.receive(Buf:Pointer;BufSize:integer):integer; +var + i,a,b:integer; + p:pointer; +begin + i := bufsize; + if recvq.size < i then i := recvq.size; + a := 0; + while (a < i) do begin + b := recvq.get(p,i-a); + move(p^,buf^,b); + inc(taddrint(buf),b); + recvq.del(b); + inc(a,b); + end; + result := i; + if wsonoreceiveloop in componentoptions then begin + if recvq.size = 0 then eventcore.rmasterset(fdhandlein,false); + end; +end; + +constructor tlasio.create; +begin + inherited create(AOwner); + sendq := tfifo.create; + recvq := tfifo.create; + state := wsclosed; + fdhandlein := -1; + fdhandleout := -1; + nextasin := firstasin; + prevasin := nil; + if assigned(nextasin) then nextasin.prevasin := self; + firstasin := self; + + released := false; +end; + +destructor tlasio.destroy; +begin + destroying := true; + if state <> wsclosed then close; + if prevasin <> nil then begin + prevasin.nextasin := nextasin; + end else begin + firstasin := nextasin; + end; + if nextasin <> nil then begin + nextasin.prevasin := prevasin; + end; + recvq.destroy; + sendq.destroy; + inherited destroy; +end; + +procedure tlasio.close; +begin + internalclose(0); +end; + +procedure tlasio.abort; +begin + close; +end; + +procedure tlasio.fdcleanup; +begin + if fdhandlein <> -1 then begin + eventcore.rmasterclr(fdhandlein); //fd_clr(fdhandlein,fdsrmaster) + end; + if fdhandleout <> -1 then begin + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster) + end; + if fdhandlein=fdhandleout then begin + if fdhandlein <> -1 then begin + myfdclose(fdhandlein); + end; + end else begin + if fdhandlein <> -1 then begin + myfdclose(fdhandlein); + end; + if fdhandleout <> -1 then begin + myfdclose(fdhandleout); + end; + end; + fdhandlein := -1; + fdhandleout := -1; +end; + +procedure tlasio.internalclose(error:word); +begin + if state<>wsclosed then begin + if (fdhandlein < 0) or (fdhandleout < 0) then raise exception.create('internalclose called with invalid fd handles'); + eventcore.rmasterclr(fdhandlein);//fd_clr(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); + + if closehandles then begin + {$ifndef win32} + //anyone remember why this is here? --plugwash + fcntl(fdhandlein,F_SETFL,0); + {$endif} + myfdclose(fdhandlein); + if fdhandleout <> fdhandlein then begin + {$ifndef win32} + fcntl(fdhandleout,F_SETFL,0); + {$endif} + myfdclose(fdhandleout); + end; + eventcore.setfdreverse(fdhandlein,nil); + eventcore.setfdreverse(fdhandleout,nil); + + fdhandlein := -1; + fdhandleout := -1; + end; + state := wsclosed; + + if assigned(onsessionclosed) then if not destroying then onsessionclosed(self,error); + end; + sendq.del(maxlongint); +end; + + +{* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *} +{ All exceptions *MUST* be handled. If an exception is not handled, the } +{ application will most likely be shut down ! } +procedure tlasio.HandleBackGroundException(E: Exception); +var + CanAbort : Boolean; +begin + CanAbort := TRUE; + { First call the error event handler, if any } + if Assigned(OnBgException) then begin + try + OnBgException(Self, E, CanAbort); + except + end; + end; + { Then abort the socket } + if CanAbort then begin + try + close; + except + end; + end; +end; + +procedure tlasio.sendstr(const str : string); +begin + putstringinsendbuffer(str); + sendflush; +end; + +procedure tlasio.putstringinsendbuffer(const newstring : string); +begin + if newstring <> '' then putdatainsendbuffer(@newstring[1],length(newstring)); +end; + +function tlasio.send(data:pointer;len:integer):integer; +begin + if state <> wsconnected then begin + result := -1; + exit; + end; + if len < 0 then len := 0; + result := len; + putdatainsendbuffer(data,len); + sendflush; +end; + + +procedure tlasio.putdatainsendbuffer(data:pointer;len:integer); +begin + sendq.add(data,len); +end; + +function tlasio.sendflush : integer; +var + lensent : integer; + data:pointer; +// fdstestr : fdset; +// fdstestw : fdset; +begin + if state <> wsconnected then exit; + + lensent := sendq.get(data,2920); + if assigned(data) then result := myfdwrite(fdhandleout,data^,lensent) else result := 0; + + if result = -1 then lensent := 0 else lensent := result; + + //sendq := copy(sendq,lensent+1,length(sendq)-lensent); + sendq.del(lensent); + + //fd_clr(fdhandleout,fdsw); // this prevents the socket being closed by a write + // that sends nothing because a previous socket has + // slready flushed this socket when the message loop + // reaches it +// if sendq.size > 0 then begin + eventcore.wmasterset(fdhandleout);//fd_set(fdhandleout,fdswmaster); +// end else begin +// wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); +// end; + if result > 0 then begin + if assigned(onsenddata) then onsenddata(self,result); +// if sendq.size=0 then if assigned(ondatasent) then begin +// tltask.create(self.dodatasent,self,0,0); +// //begin test code +// fd_zero(fdstestr); +// fd_zero(fdstestw); +// fd_set(fdhandlein,fdstestr); +// fd_set(fdhandleout,fdstestw); +// select(maxs,@fdstestr,@fdstestw,nil,0); +// writeln(fd_isset(fdhandlein,fdstestr),' ',fd_isset(fdhandleout,fdstestw)); +// //end test code +// +// end; + writtenthiscycle := true; + end; +end; + +procedure tlasio.dupnowatch(invalue:longint); +begin + { debugout('invalue='+inttostr(invalue));} + //readln; + if state<> wsclosed then close; + fdhandlein := invalue; + fdhandleout := invalue; + eventcore.setfdreverse(fdhandlein,self); + {$ifndef win32} + fcntl(fdhandlein,F_SETFL,OPEN_NONBLOCK); + {$endif} + state := wsconnected; + +end; + + +procedure tlasio.dup(invalue:longint); +begin + dupnowatch(invalue); + eventcore.rmasterset(fdhandlein,false);//fd_set(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); +end; + + +procedure tlasio.handlefdtrigger(readtrigger,writetrigger:boolean); +var + sendflushresult : integer; + tempbuf:array[0..receivebufsize-1] of byte; +begin + if (state=wsconnected) and writetrigger then begin + //writeln('write trigger'); + + if (sendq.size >0) then begin + + sendflushresult := sendflush; + if (sendflushresult <= 0) and (not writtenthiscycle) then begin + if sendflushresult=0 then begin // linuxerror := 0; + internalclose(0); + + end else begin + internalclose({$ifdef win32}getlasterror{$else}linuxerror{$endif}); + end; + end; + + end else begin + //everything is sent fire off ondatasent event + if fdhandleout >= 0 then eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); + if assigned(ondatasent) then tltask.create(self.dodatasent,self,0,0); + end; + if assigned(onfdwrite) then onfdwrite(self,0); + end; + writtenthiscycle := false; + if (state =wsconnected) and readtrigger then begin + if recvq.size=0 then begin + numread := myfdread(fdhandlein,tempbuf,sizeof(tempbuf)); + if (numread=0) and (not mustrefreshfds) then begin + {if i remember correctly numread=0 is caused by eof + if this isn't dealt with then you get a cpu eating infinite loop + however if onsessionconencted has called processmessages that could + cause us to drop to here with an empty recvq and nothing left to read + and we don't want that to cause the socket to close} + + internalclose(0); + end else if (numread=-1) then begin + numread := 0; + internalclose({$ifdef win32}getlasterror{$else}linuxerror{$endif}); + end else if numread > 0 then recvq.add(@tempbuf,numread); + end; + + if recvq.size > 0 then begin + if wsonoreceiveloop in componentoptions then eventcore.rmasterclr(fdhandlein); //fd_clr(fdhandlein,fdsrmaster); + if assigned(ondataavailable) then ondataAvailable(self,0); + if not (wsonoreceiveloop in componentoptions) then if recvq.size > 0 then + tltask.create(self.doreceiveloop,self,0,0); + end; + //until (numread = 0) or (currentsocket.state<>wsconnected); +{ debugout('inner loop complete');} + end; +end; + +{$ifndef win32} + procedure tlasio.flush; + var + fds : fdset; + begin + fd_zero(fds); + fd_set(fdhandleout,fds); + while sendq.size>0 do begin + select(fdhandleout+1,nil,@fds,nil,nil); + if sendflush <= 0 then exit; + end; + end; +{$endif} + +procedure tlasio.dodatasent(wparam,lparam:longint); +begin + if assigned(ondatasent) then ondatasent(self,lparam); +end; + +procedure tlasio.deletebuffereddata; +begin + sendq.del(maxlongint); +end; + +procedure tlasio.sinkdata(sender:tobject;error:word); +begin + tlasio(sender).recvq.del(maxlongint); +end; + +{$ifndef win32} + procedure tltimer.resettimes; + begin + gettimeofday(nextts); + {if not initialevent then} tv_add(nextts,interval); + end; +{$endif} + +{procedure tltimer.setinitialevent(newvalue : boolean); +begin + if newvalue <> finitialevent then begin + finitialevent := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setinitialevent(wrappedtimer,newvalue); + end else begin + resettimes; + end; + end; +end;} + +procedure tltimer.setontimer(newvalue:tnotifyevent); +begin + if @newvalue <> @fontimer then begin + fontimer := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setontimer(wrappedtimer,newvalue); + end else begin + + end; + end; + +end; + + +procedure tltimer.setenabled(newvalue : boolean); +begin + if newvalue <> fenabled then begin + fenabled := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setenabled(wrappedtimer,newvalue); + end else begin + {$ifdef win32} + raise exception.create('non wrapper timers are not permitted on windows'); + {$else} + resettimes; + {$endif} + end; + end; +end; + +procedure tltimer.setinterval(newvalue:integer); +begin + if newvalue <> finterval then begin + finterval := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setinterval(wrappedtimer,newvalue); + end else begin + {$ifdef win32} + raise exception.create('non wrapper timers are not permitted on windows'); + {$else} + resettimes; + {$endif} + end; + end; + +end; + + + + +constructor tltimer.create; +begin + inherited create(AOwner); + if assigned(timerwrapperinterface) then begin + wrappedtimer := timerwrapperinterface.createwrappedtimer; + end else begin + + + nexttimer := firsttimer; + prevtimer := nil; + + if assigned(nexttimer) then nexttimer.prevtimer := self; + firsttimer := self; + end; + interval := 1000; + enabled := true; + released := false; + +end; + +destructor tltimer.destroy; +begin + if assigned(timerwrapperinterface) then begin + wrappedtimer.free; + end else begin + if prevtimer <> nil then begin + prevtimer.nexttimer := nexttimer; + end else begin + firsttimer := nexttimer; + end; + if nexttimer <> nil then begin + nexttimer.prevtimer := prevtimer; + end; + + end; + inherited destroy; +end; + +constructor tltask.create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + inherited create; + if assigned(onaddtask) then onaddtask(ahandler,aobj,awparam,alparam); + handler := ahandler; + obj := aobj; + wparam := awparam; + lparam := alparam; + {nexttask := firsttask; + firsttask := self;} + if assigned(lasttask) then begin + lasttask.nexttask := self; + end else begin + firsttask := self; + end; + lasttask := self; + //ahandler(wparam,lparam); +end; + +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + + tltask.create(ahandler,aobj,awparam,alparam); +end; + + + + +{$ifndef nosignal} + procedure prepsigpipe;inline; + begin + starthandlesignal(sigpipe); + if not assigned(signalloopback) then begin + signalloopback := tlloopback.create(nil); + signalloopback.ondataAvailable := signalloopback.sinkdata; + + end; + + end; +{$endif} + +procedure processtasks;//inline; +var + temptask : tltask ; + +begin + + if not assigned(currenttask) then begin + currenttask := firsttask; + firsttask := nil; + lasttask := nil; + end; + while assigned(currenttask) do begin + + if assigned(currenttask.handler) then currenttask.handler(currenttask.wparam,currenttask.lparam); + if assigned(currenttask) then begin + temptask := currenttask; + currenttask := currenttask.nexttask; + temptask.free; + end; + //writeln('processed a task'); + end; + +end; + + + + +procedure disconnecttasks(aobj:tobject); +var + currenttasklocal : tltask ; + counter : byte ; +begin + for counter := 0 to 1 do begin + if counter = 0 then begin + currenttasklocal := firsttask; //main list of tasks + end else begin + currenttasklocal := currenttask; //needed in case called from a task + end; + // note i don't bother to sestroy the links here as that will happen when + // the list of tasks is processed anyway + while assigned(currenttasklocal) do begin + if currenttasklocal.obj = aobj then begin + currenttasklocal.obj := nil; + currenttasklocal.handler := nil; + end; + currenttasklocal := currenttasklocal.nexttask; + end; + end; +end; + + +procedure processmessages; +begin + eventcore.processmessages; +end; +procedure messageloop; +begin + eventcore.messageloop; +end; + +procedure exitmessageloop; +begin + eventcore.exitmessageloop; +end; + +function tlasio.RealSend(Data : Pointer; Len : Integer) : Integer; +begin + result := myfdwrite(fdhandleout,data^,len); + if (result > 0) and assigned(onsenddata) then onsenddata(self,result); + eventcore.wmasterset(fdhandleout); +end; +{$ifndef win32} + procedure tlasio.myfdclose(fd : integer); + begin + fdclose(fd); + end; + function tlasio.myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; + begin + result := fdwrite(fd,buf,size); + end; + + function tlasio.myfdread(fd: LongInt;var buf;size: LongInt):LongInt; + begin + result := fdread(fd,buf,size); + end; + + +{$endif} + + +begin + firstasin := nil; + firsttask := nil; + + + {$ifndef nosignal} + signalloopback := nil; + {$endif} +end. + + + + + diff --git a/httpserver_20080306/lcoregtklaz.pas b/httpserver_20080306/lcoregtklaz.pas new file mode 100755 index 0000000..bbf4418 --- /dev/null +++ b/httpserver_20080306/lcoregtklaz.pas @@ -0,0 +1,142 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit lcoregtklaz; +{$mode delphi} +interface + +uses baseunix,unix,glib, gdk, gtk,lcore,forms,fd_utils,classes; +//procedure lcoregtklazrun; +const + G_IO_IN=1; + G_IO_OUT=4; + G_IO_PRI=2; + G_IO_ERR=8; + + G_IO_HUP=16; + G_IO_NVAL=32; +type + tlaztimerwrapperinterface=class(ttimerwrapperinterface) + public + function createwrappedtimer : tobject;override; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);override; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);override; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);override; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);override; + end; + +procedure lcoregtklazinit; +implementation + uses + ExtCtrls; +{$I unixstuff.inc} +var + giochannels : array[0..absoloutemaxs] of pgiochannel; + +function iocallback(source:PGIOChannel; condition:TGIOCondition; data:gpointer):gboolean;cdecl; +// return true if we want the callback to stay +var + fd : integer ; + fdsrlocal , fdswlocal : fdset ; + currentasio : tlasio ; +begin + fd := g_io_channel_unix_get_fd(source); + fd_zero(fdsrlocal); + fd_set(fd,fdsrlocal); + fdswlocal := fdsrlocal; + select(fd+1,@fdsrlocal,@fdswlocal,nil,0); + if fd_isset(fd,fdsrlocal) or fd_isset(fd,fdsrlocal) then begin + currentasio := fdreverse[fd]; + if assigned(currentasio) then begin + currentasio.handlefdtrigger(fd_isset(currentasio.fdhandlein,fdsrlocal),fd_isset(currentasio.fdhandleout,fdswlocal)); + end else begin + rmasterclr(fd); + wmasterclr(fd); + end; + end; + case condition of + G_IO_IN : begin + result := rmasterisset(fd); + end; + G_IO_OUT : begin + result := wmasterisset(fd); + end; + end; +end; + +procedure gtkrmasterset(fd : integer); +begin + if not assigned(giochannels[fd]) then giochannels[fd] := g_io_channel_unix_new(fd); + g_io_add_watch(giochannels[fd],G_IO_IN,iocallback,nil); +end; + +procedure gtkrmasterclr(fd: integer); +begin +end; + +procedure gtkwmasterset(fd : integer); +begin + if not assigned(giochannels[fd]) then giochannels[fd] := g_io_channel_unix_new(fd); + g_io_add_watch(giochannels[fd],G_IO_OUT,iocallback,nil); +end; + +procedure gtkwmasterclr(fd: integer); +begin +end; + +type + tsc = class + procedure dotasksandsink(sender:tobject;error:word); + end; +var + taskloopback : tlloopback; + sc : tsc; +procedure tsc.dotasksandsink(sender:tobject;error:word); +begin + with tlasio(sender) do begin + sinkdata(sender,error); + processtasks; + end; +end; +procedure gtkaddtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + taskloopback.sendstr(' '); + +end; + +procedure lcoregtklazinit; +begin + onrmasterset := gtkrmasterset; + onrmasterclr := gtkrmasterclr; + onwmasterset := gtkwmasterset; + onwmasterclr := gtkwmasterclr; + onaddtask := gtkaddtask; + taskloopback := tlloopback.create(nil); + taskloopback.ondataavailable := sc.dotasksandsink; + timerwrapperinterface := tlaztimerwrapperinterface.create(nil); +end; + +function tlaztimerwrapperinterface.createwrappedtimer : tobject; +begin + result := ttimer.create(nil); +end; +procedure tlaztimerwrapperinterface.setontimer(wrappedtimer : tobject;newvalue:tnotifyevent); +begin + ttimer(wrappedtimer).ontimer := newvalue; +end; +procedure tlaztimerwrapperinterface.setenabled(wrappedtimer : tobject;newvalue : boolean); +begin + ttimer(wrappedtimer).enabled := newvalue; +end; + + +procedure tlaztimerwrapperinterface.setinterval(wrappedtimer : tobject;newvalue : integer); +begin + ttimer(wrappedtimer).interval := newvalue; +end; + + +end. + diff --git a/httpserver_20080306/lcoreselect.pas b/httpserver_20080306/lcoreselect.pas new file mode 100755 index 0000000..0369448 --- /dev/null +++ b/httpserver_20080306/lcoreselect.pas @@ -0,0 +1,391 @@ +{lsocket.pas} + +{io and timer code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + + +unit lcoreselect; + + +interface +uses + fd_utils; +var + maxs : longint ; + exitloopflag : boolean ; {if set by app, exit mainloop} + +function getfdsrmaster : fdset; {$ifdef fpc}inline;{$endif} +function getfdswmaster : fdset; {$ifdef fpc}inline;{$endif} + +implementation +uses + lcore,sysutils, + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix, + {$endif} + classes,pgtypes,bfifo, + {$ifndef nosignal} + lsignal; + {$endif} + +{$include unixstuff.inc} +{$include ltimevalstuff.inc} +var + fdreverse:array[0..absoloutemaxs] of tlasio; +type + tselecteventcore=class(teventcore) + public + procedure processmessages; override; + procedure messageloop; override; + procedure exitmessageloop;override; + procedure setfdreverse(fd : integer;reverseto : tlasio); override; + procedure rmasterset(fd : integer;islistensocket : boolean); override; + procedure rmasterclr(fd: integer); override; + procedure wmasterset(fd : integer); override; + procedure wmasterclr(fd: integer); override; + end; + +procedure processtimers;inline; +var + tv ,tvnow : ttimeval ; + currenttimer : tltimer ; + temptimer : tltimer ; + +begin + gettimeofday(tvnow); + currenttimer := firsttimer; + while assigned(currenttimer) do begin + //writeln(currenttimer.enabled); + if tv_compare(tvnow,ttimeval(currenttimer.nextts)) and currenttimer.enabled then begin + //if assigned(currenttimer.ontimer) then begin + // if currenttimer.enabled then if currenttimer.initialevent or currenttimer.initialdone then currenttimer.ontimer(currenttimer); + // currenttimer.initialdone := true; + //end; + if assigned(currenttimer.ontimer) then currenttimer.ontimer(currenttimer); + currenttimer.nextts := timeval(tvnow); + tv_add(ttimeval(currenttimer.nextts),currenttimer.interval); + end; + temptimer := currenttimer; + currenttimer := currenttimer.nexttimer; + if temptimer.released then temptimer.free; + end; +end; + +procedure processasios(var fdsr,fdsw:fdset);//inline; +var + currentsocket : tlasio ; + tempsocket : tlasio ; + socketcount : integer ; // for debugging perposes :) + dw,bt:integer; +begin +{ inc(lcoretestcount);} + + //the message loop will exit if all lasio's and ltimer's and lsignal's are destroyed + //if (not assigned(firstasin)) and (not assigned(firsttimer)) and (not assigned(firstsignal)) then exit; + + + {------- test optimised loop} + socketcount := 0; + for dw := (maxs shr 5) downto 0 do if (fdsr[dw] or fdsw[dw]) <> 0 then begin + for bt := 0 to 31 do if (fdsr[dw] or fdsw[dw]) and (1 shl bt) <> 0 then begin + inc(socketcount); + currentsocket := fdreverse[dw shl 5 or bt]; + {if not assigned(currentsocket) then raise exception.create('currentsocket not assigned'); + if currentsocket.fdhandlein < 0 then raise exception.create('currentsocket.fdhandlein out of range');} + {i've seen the out of range case actually happening, so it can happen. test: just close the fd - beware} + if not assigned(currentsocket) then begin + fdclose(dw shl 5 or bt); + continue + end; + if currentsocket.fdhandlein < 0 then begin + fdclose(dw shl 5 or bt); + continue + end; + try + currentsocket.handlefdtrigger(fd_isset(currentsocket.fdhandlein,fdsr),fd_isset(currentsocket.fdhandleout,fdsw)); + except + on E: exception do begin + currentsocket.HandleBackGroundException(e); + end; + end; + + if mustrefreshfds then begin + if select(maxs+1,@fdsr,@fdsw,nil,0) <= 0 then begin + fd_zero(fdsr); + fd_zero(fdsw); + end; + end; + end; + end; + + if asinreleaseflag then begin + asinreleaseflag := false; + currentsocket := firstasin; + while assigned(currentsocket) do begin + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + if tempsocket.released then begin + tempsocket.free; + end; + end; + end; + { + !!! issues: + - sockets which are released may not be freed because theyre never processed by the loop + made new code for handling this, using asinreleaseflag + + - when/why does the mustrefreshfds select apply, sheck if i did it correctly? + + - what happens if calling handlefdtrigger for a socket which does not have an event + } + {------- original loop} + + (* + currentsocket := firstasin; + socketcount := 0; + while assigned(currentsocket) do begin + if mustrefreshfds then begin + if select(maxs,@fdsr,@fdsw,nil,0) <= 0 then begin + fd_zero(fdsr); + fd_zero(fdsw); + end; + end; + try + if fd_isset(currentsocket.fdhandlein,fdsr) or fd_isset(currentsocket.fdhandleout,fdsw) then begin + currentsocket.handlefdtrigger(fd_isset(currentsocket.fdhandlein,fdsr),fd_isset(currentsocket.fdhandleout,fdsw)); + end; + except + on E: exception do begin + currentsocket.HandleBackGroundException(e); + end; + end; + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + inc(socketcount); + if tempsocket.released then begin + tempsocket.free; + end; + end; *) +{ debugout('socketcount='+inttostr(socketcount));} +end; + +procedure tselecteventcore.processmessages; +var + fdsr , fdsw : fdset ; + selectresult : longint ; +begin + mustrefreshfds := false; + {$ifndef nosignal} + prepsigpipe; + {$endif} + selectresult := select(maxs+1,@fdsr,@fdsw,nil,0); + while (selectresult>0) or assigned(firsttask) or assigned(currenttask) do begin; + + processtasks; + processtimers; + if selectresult > 0 then begin + processasios(fdsr,fdsw); + end; + selectresult := select(maxs+1,@fdsr,@fdsw,nil,0); + + end; + mustrefreshfds := true; +end; + + +var + FDSR , FDSW : fdset; + +Function doSelect(timeOut:PTimeVal):longint;//inline; +var + localtimeval : ttimeval; + maxslocal : integer; +begin + //unblock signals + //zeromemory(@sset,sizeof(sset)); + //sset[0] := ; + fdsr := getfdsrmaster; + fdsw := getfdswmaster; + + if assigned(firsttask) then begin + localtimeval.tv_sec := 0; + localtimeval.tv_usec := 0; + timeout := @localtimeval; + end; + + maxslocal := maxs; + mustrefreshfds := false; +{ debugout('about to call select');} + {$ifndef nosignal} + sigprocmask(SIG_UNBLOCK,@blockset,nil); + {$endif} + result := select(maxslocal+1,@FDSR,@FDSW,nil,timeout); + if result <= 0 then begin + fd_zero(FDSR); + fd_zero(FDSW); + if result=-1 then begin + if linuxerror = SYS_EINTR then begin + // we received a signal it's not a problem + end else begin + raise esocketexception.create('select returned error '+inttostr(linuxerror)); + end; + end; + end; + {$ifndef nosignal} + sigprocmask(SIG_BLOCK,@blockset,nil); + {$endif} +{ debugout('select complete');} +end; + +procedure tselecteventcore.exitmessageloop; +begin + exitloopflag := true +end; + + + +procedure tselecteventcore.messageloop; +var + tv ,tvnow : ttimeval ; + currenttimer : tltimer ; + selectresult:integer; +begin + {$ifndef nosignal} + prepsigpipe; + {$endif} + {currentsocket := firstasin; + if not assigned(currentsocket) then exit; //the message loop will exit if all lsockets are destroyed + repeat + + if currentsocket.state = wsconnected then currentsocket.sendflush; + currentsocket := currentsocket.nextasin; + until not assigned(currentsocket);} + + + repeat + + //the message loop will exit if all lasio's and ltimer's and lsignal's are destroyed + if (not assigned(firstasin)) and (not assigned(firsttimer)) {$ifndef nosignal} and (not assigned(firstsignal)){$endif} then exit; + {fd_zero(FDSR); + fd_zero(FDSW); + currentsocket := firstasin; + if not assigned(currentsocket) then exit; //the message loop will exit if all lsockets are destroyed + + repeat + if (not currentsocket.released) and (currentsocket.state<>wsclosed) then fd_set(currentsocket.fdhandlein,fdsr); + if (not currentsocket.released) and (currentsocket.state=wsconnecting) then fd_set(currentsocket.fdhandleout,fdsw); + if currentsocket is tlsocket then begin + if (not currentsocket.released) and (currentsocket.state=wsconnected) and(tlsocket(currentsocket).sendq <> '') then fd_set(currentsocket.fdhandleout,fdsw); + end; + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + if tempsocket.released then begin + tempsocket.free; + end; + until not assigned(currentsocket); + } + processtasks; + //currenttask := nil; + {beware} + //if assigned(firsttimer) then begin + // tv.tv_sec := maxlongint; + tv := tv_invalidtimebig; + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if tv_compare(tv,currenttimer.nextts) and currenttimer.enabled then tv := currenttimer.nextts; + currenttimer := currenttimer.nexttimer; + end; + + + if tv_compare(tv,tv_invalidtimebig) then begin + //writeln('no timers active'); + if exitloopflag then break; +{ sleep(10);} + selectresult := doselect(nil); + + end else begin + gettimeofday(tvnow); + tv_substract(tv,tvnow); + + //writeln('timers active'); + if tv.tv_sec < 0 then begin + tv.tv_sec := 0; + tv.tv_usec := 0; {0.1 sec} + end; + if exitloopflag then break; +{ sleep(10);} + selectresult := doselect(@tv); + processtimers; + + end; + if selectresult > 0 then processasios(fdsr,fdsw); + {!!!only call processasios if select has asio events -beware} + + {artificial delay to throttle the number of processasios per second possible and reduce cpu usage} + until false; +end; + +var + fdsrmaster , fdswmaster : fdset ; + +procedure tselecteventcore.rmasterset(fd : integer;islistensocket : boolean); +begin + if fd > absoloutemaxs then raise esocketexception.create('file discriptor out of range'); + if fd > maxs then maxs := fd; + if fd_isset(fd,fdsrmaster) then exit; + fd_set(fd,fdsrmaster); + +end; + +procedure tselecteventcore.rmasterclr(fd: integer); +begin + if not fd_isset(fd,fdsrmaster) then exit; + fd_clr(fd,fdsrmaster); + +end; + + +procedure tselecteventcore.wmasterset(fd : integer); +begin + if fd > absoloutemaxs then raise esocketexception.create('file discriptor out of range'); + if fd > maxs then maxs := fd; + + if fd_isset(fd,fdswmaster) then exit; + fd_set(fd,fdswmaster); + +end; + +procedure tselecteventcore.wmasterclr(fd: integer); +begin + if not fd_isset(fd,fdswmaster) then exit; + fd_clr(fd,fdswmaster); +end; + +procedure tselecteventcore.setfdreverse(fd : integer;reverseto : tlasio); +begin + fdreverse[fd] := reverseto; +end; + +function getfdsrmaster : fdset; {$ifdef fpc}inline;{$endif} +begin + result := fdsrmaster; +end; +function getfdswmaster : fdset; {$ifdef fpc}inline;{$endif} +begin + result := fdswmaster; +end; + + +begin + eventcore := tselecteventcore.create; + + maxs := 0; + fd_zero(fdsrmaster); + fd_zero(fdswmaster); +end. diff --git a/httpserver_20080306/lcoretest.dpr b/httpserver_20080306/lcoretest.dpr new file mode 100755 index 0000000..e9d1b0a --- /dev/null +++ b/httpserver_20080306/lcoretest.dpr @@ -0,0 +1,167 @@ +program lcoretest; + +uses + lcore, + lsocket, + {$ifdef win32} + lcorewsaasyncselect in 'lcorewsaasyncselect.pas', + {$else} + lcoreselect, + {$endif} + dnsasync, + binipstuff, + dnssync; +{$ifdef win32} + {$R *.RES} +{$endif} + +type + tsc=class + procedure sessionavailable(sender: tobject;error : word); + procedure dataavailable(sender: tobject;error : word); + procedure sessionconnected(sender: tobject;error : word); + procedure taskrun(wparam,lparam:longint); + procedure timehandler(sender:tobject); + procedure dnsrequestdone(sender:tobject;error : word); + procedure sessionclosed(sender:tobject;error : word); + end; +var + listensocket : tlsocket; + serversocket : tlsocket; + clientsocket : tlsocket; + sc : tsc; + task : tltask; +procedure tsc.sessionavailable(sender: tobject;error : word); +begin + writeln('received connection'); + serversocket.dup(listensocket.accept); +end; + +var + receivebuf : string; + receivecount : integer; +procedure tsc.dataavailable(sender: tobject;error : word); +var + receiveddata : string; + receivedon : string; +begin + receiveddata := tlsocket(sender).receivestr; + if sender=clientsocket then begin + receivedon := 'client socket'; + end else begin + receivedon := 'server socket'; + end; + writeln('received data '+receiveddata+' on '+receivedon); + if sender=serversocket then begin + receivebuf := receivebuf+receiveddata; + end; + if receivebuf = 'hello world' then begin + receivebuf := ''; + writeln('received hello world creating task'); + task := tltask.create(sc.taskrun,nil,0,0); + end; + receivecount := receivecount +1; + if receivecount >50 then begin + writeln('received over 50 bits of data, pausing to let the operator take a look'); + readln; + receivecount := 0; + end; + +end; + +procedure tsc.sessionconnected(sender: tobject;error : word); +begin + if error=0 then begin + writeln('session is connected'); + if clientsocket.addr = '127.0.0.1' then begin + clientsocket.sendstr('hello world'); + end else begin + clientsocket.sendstr('get /'#13#10#13#10); + end; + end else begin + writeln('connect failed'); + end; +end; + +var + das : tdnsasync; + +procedure tsc.taskrun(wparam,lparam:longint); +var + tempbinip : tbinip; + dummy : integer; +begin + writeln('task ran'); + writeln('closing client socket'); + clientsocket.close; + + writeln('looking up www.kame.net using dnsasync'); + das := tdnsasync.Create(nil); + das.onrequestdone := sc.dnsrequestdone; + das.forwardfamily := af_inet6; + das.forwardlookup('www.kame.net'); +end; + +procedure tsc.dnsrequestdone(sender:tobject;error : word); +begin + writeln('www.kame.net resolved to '+das.dnsresult+' connecting client socket there'); + clientsocket.addr := das.dnsresult; + clientsocket.port := '80'; + clientsocket.connect; + das.free; +end; + +procedure tsc.timehandler(sender:tobject); +begin + //writeln('got timer event'); +end; +procedure tsc.sessionclosed(sender:tobject;error : word); +begin + Writeln('session closed with error ',error); +end; +var + timer : tltimer; + ipbin : tbinip; + dummy : integer; +begin + ipbin := forwardlookup('invalid.domain',5); + writeln(ipbintostr(ipbin)); + + ipbin := forwardlookup('p10link.net',5); + writeln(ipbintostr(ipbin)); + + ipstrtobin('80.68.89.68',ipbin); + writeln('80.68.89.68 reverses to '+reverselookup(ipbin,5)); + + ipstrtobin('2001:200::8002:203:47ff:fea5:3085',ipbin); + writeln('2001:200::8002:203:47ff:fea5:3085 reverses to '+reverselookup(ipbin,5)); + writeln('creating and setting up listen socket'); + listensocket := tlsocket.create(nil); + listensocket.addr := '0.0.0.0'; + listensocket.port := '12345'; + listensocket.onsessionavailable := sc.sessionavailable; + writeln('listening'); + listensocket.listen; + writeln('listen socket is number ', listensocket.fdhandlein); + writeln('creating and setting up server socket'); + serversocket := tlsocket.create(nil); + serversocket.ondataavailable := sc.dataavailable; + writeln('creating and setting up client socket'); + clientsocket := tlsocket.create(nil); + clientsocket.addr := {'::1';}'127.0.0.1'; + clientsocket.port := '12345'; + clientsocket.onsessionconnected := sc.sessionconnected; + clientsocket.ondataAvailable := sc.dataavailable; + clientsocket.onsessionclosed := sc.sessionclosed; + writeln('connecting'); + clientsocket.connect; + writeln('client socket is number ',clientsocket.fdhandlein); + writeln('creating and setting up timer'); + timer := tltimer.create(nil); + timer.interval := 1000; + timer.ontimer := sc.timehandler; + timer.enabled := true; + writeln('entering message loop'); + messageloop; + writeln('exiting cleanly'); +end. diff --git a/httpserver_20080306/lcorewsaasyncselect.pas b/httpserver_20080306/lcorewsaasyncselect.pas new file mode 100755 index 0000000..a978c23 --- /dev/null +++ b/httpserver_20080306/lcorewsaasyncselect.pas @@ -0,0 +1,216 @@ +unit lcorewsaasyncselect; + +interface + +implementation +uses wcore,lcore,bsearchtree,sysutils,windows,winsock,pgtypes,messages,classes; +type + twineventcore=class(teventcore) + public + procedure processmessages; override; + procedure messageloop; override; + procedure exitmessageloop;override; + procedure setfdreverse(fd : integer;reverseto : tlasio); override; + procedure rmasterset(fd : integer;islistensocket : boolean); override; + procedure rmasterclr(fd: integer); override; + procedure wmasterset(fd : integer); override; + procedure wmasterclr(fd: integer); override; + end; +const + wm_dotasks=wm_user+1; +type + twintimerwrapperinterface=class(ttimerwrapperinterface) + public + function createwrappedtimer : tobject;override; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);override; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);override; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);override; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);override; + end; + +procedure twineventcore.processmessages; +begin + wcore.processmessages;//pass off to wcore +end; +procedure twineventcore.messageloop; +begin + wcore.messageloop; //pass off to wcore +end; +procedure twineventcore.exitmessageloop; +begin + wcore.exitmessageloop; +end; +var + fdreverse : thashtable; + fdwatches : thashtable; + +procedure twineventcore.setfdreverse(fd : integer;reverseto : tlasio); +begin + if findtree(@fdreverse,inttostr(fd)) <> nil then deltree(@fdreverse,inttostr(fd)); + if reverseto <> nil then addtree(@fdreverse,inttostr(fd),reverseto); +end; + +var + hwndlcore : hwnd; +procedure dowsaasyncselect(fd:integer; leventadd: integer; leventremove : integer); +var + leventold : integer; + leventnew : integer; + wsaaresult : integer; +begin + leventold := taddrint(findtree(@fdwatches,inttostr(fd))); + leventnew := leventold or leventadd; + leventnew := leventnew and not leventremove; + if leventold <> leventnew then begin + if leventold <> 0 then deltree(@fdwatches,inttostr(fd)); + if leventnew <> 0 then addtree(@fdwatches,inttostr(fd),pointer(leventnew)); + end; + wsaaresult := wsaasyncselect(fd,hwndlcore,wm_user,leventnew); + +end; + + +//to allow detection of errors: +//if we are asked to monitor for read or accept we also monitor for close +//if we are asked to monitor for write we also monitor for connect + + +procedure twineventcore.rmasterset(fd : integer;islistensocket : boolean); +begin + if islistensocket then begin + //writeln('setting accept watch for socket number ',fd); + dowsaasyncselect(fd,FD_ACCEPT or FD_CLOSE,0); + end else begin + //writeln('setting read watch for socket number',fd); + dowsaasyncselect(fd,FD_READ or FD_CLOSE,0); + end; +end; +procedure twineventcore.rmasterclr(fd: integer); +begin + //writeln('clearing read of accept watch for socket number ',fd); + dowsaasyncselect(fd,0,FD_ACCEPT or FD_READ or FD_CLOSE); +end; +procedure twineventcore.wmasterset(fd : integer); +begin + dowsaasyncselect(fd,FD_WRITE or FD_CONNECT,0); +end; + +procedure twineventcore.wmasterclr(fd: integer); +begin + dowsaasyncselect(fd,0,FD_WRITE or FD_CONNECT); +end; + +var + tasksoutstanding : boolean; + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + socket : integer; + event : integer; + error : integer; + readtrigger : boolean; + writetrigger : boolean; + lasio : tlasio; +begin + //writeln('got a message'); + Result := 0; // This means we handled the message + if (ahwnd=hwndlcore) and (aumsg=wm_user) then begin + //writeln('it appears to be a response to our wsaasyncselect'); + socket := awparam; + event := alparam and $FFFF; + error := alparam shr 16; + //writeln('socket=',socket,' event=',event,' error=',error); + readtrigger := false; + writetrigger := false; + lasio := findtree(@fdreverse,inttostr(socket)); + if assigned(lasio) then begin + if (error <> 0) or ((event and FD_CLOSE) <> 0) then begin + if lasio.state = wsconnecting then begin + lasio.onsessionconnected(lasio,error); + end; + lasio.internalclose(error); + end else begin + if (event and (FD_READ or FD_ACCEPT)) <> 0 then readtrigger := true; + if (event and (FD_WRITE)) <> 0 then writetrigger := true; + + if readtrigger or writetrigger then lasio.handlefdtrigger(readtrigger,writetrigger); + end; + dowsaasyncselect(socket,0,0); //reset watches + end; + end else if (ahwnd=hwndlcore) and (aumsg=wm_dotasks) then begin + //writeln('processing tasks'); + tasksoutstanding := false; + processtasks; + end else begin + //writeln('passing unknown message to defwindowproc'); + //not passing unknown messages on to defwindowproc will cause window + //creation to fail! --plugwash + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; + +end; + +procedure winaddtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + if not tasksoutstanding then PostMessage(hwndlcore,wm_dotasks,0,0); +end; +type + twcoretimer = wcore.tltimer; + +function twintimerwrapperinterface.createwrappedtimer : tobject; +begin + result := twcoretimer.create(nil); +end; +procedure twintimerwrapperinterface.setontimer(wrappedtimer : tobject;newvalue:tnotifyevent); +begin + twcoretimer(wrappedtimer).ontimer := newvalue; +end; +procedure twintimerwrapperinterface.setenabled(wrappedtimer : tobject;newvalue : boolean); +begin + twcoretimer(wrappedtimer).enabled := newvalue; +end; + + +procedure twintimerwrapperinterface.setinterval(wrappedtimer : tobject;newvalue : integer); +begin + twcoretimer(wrappedtimer).interval := newvalue; +end; + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'lcoreClass'); + GInitData: TWSAData; + +begin + eventcore := twineventcore.create; + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create lcore handle, hinstance=',hinstance); + hwndlcore := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + //writeln('lcore hwnd is ',hwndlcore); + //writeln('last error is ',GetLastError); + onaddtask := winaddtask; + timerwrapperinterface := twintimerwrapperinterface.create(nil); + + WSAStartup($200, GInitData); +end. diff --git a/httpserver_20080306/lloopback.pas b/httpserver_20080306/lloopback.pas new file mode 100755 index 0000000..da26263 --- /dev/null +++ b/httpserver_20080306/lloopback.pas @@ -0,0 +1,30 @@ +unit lloopback; + +interface +uses lcore,classes; + +type + tlloopback=class(tlasio) + public + constructor create(aowner:tcomponent); override; + end; + + +implementation +uses + baseunix,unix; +{$i unixstuff.inc} + +constructor tlloopback.create(aowner:tcomponent); +begin + inherited create(aowner); + closehandles := true; + assignpipe(fdhandlein,fdhandleout); + + eventcore.rmasterset(fdhandlein,false);//fd_set(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandlein);//fd_clr(fdhandleout,fdswmaster); + eventcore.setfdreverse(fdhandlein,self); + eventcore.setfdreverse(fdhandleout,self); + state := wsconnected; +end; +end. diff --git a/httpserver_20080306/lmessages.pas b/httpserver_20080306/lmessages.pas new file mode 100755 index 0000000..7bb73fd --- /dev/null +++ b/httpserver_20080306/lmessages.pas @@ -0,0 +1,656 @@ +unit lmessages; +//windows messages like system based on lcore tasks +interface + +uses pgtypes,sysutils,bsearchtree,strings,syncobjs; + +type + lparam=taddrint; + wparam=taddrint; + thinstance=pointer; + hicon=pointer; + hcursor=pointer; + hbrush=pointer; + hwnd=qword; //window handles are monotonically increasing 64 bit integers, + //this should allow for a million windows per second for over half + //a million years! + + twndproc=function(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; + + + twndclass=record + style : dword; + lpfnwndproc : twndproc; + cbclsextra : integer; + cbwndextra : integer; + hinstance : thinstance; + hicon : hicon; + hcursor : hcursor; + hbrbackground : hbrush; + lpszmenuname : pchar; + lpszclassname : pchar; + end; + PWNDCLASS=^twndclass; + + UINT=dword; + WINBOOL = longbool; + tTIMERPROC = procedure (ahwnd:HWND; umsg:integer; idevent:taddrint;dwtime:taddrint);stdcall; + ATOM = pointer; + LPCSTR = pchar; + LPVOID = pointer; + HMENU = pointer; + HINST = pointer; + + TPOINT = record + x : LONGint; + y : LONGint; + end; + + TMSG = record + hwnd : HWND; + message : UINT; + wParam : WPARAM; + lParam : LPARAM; + time : DWORD; + pt : TPOINT; + end; + THevent=TEventObject; +const + WS_EX_TOOLWINDOW = $80; + WS_POPUP = longint($80000000); + hinstance=nil; + PM_REMOVE = 1; + WM_USER = 1024; + WM_TIMER = 275; + INFINITE = syncobjs.infinite; +function getwindowlongptr(ahwnd:hwnd;nindex:integer) : taddrint; +function setwindowlongptr(ahwnd:hwnd;nindex:integer;dwNewLong : taddrint) : taddrint; +function DefWindowProc(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; +function RegisterClass(const lpWndClass:TWNDCLASS):ATOM; +function CreateWindowEx(dwExStyle:DWORD; lpClassName:LPCSTR; lpWindowName:LPCSTR; dwStyle:DWORD; X:longint;Y:longint; nWidth:longint; nHeight:longint; hWndParent:HWND; hMenu:HMENU;hInstance:HINST; lpParam:LPVOID):HWND; +function DestroyWindow(ahWnd:HWND):WINBOOL; +function PostMessage(hWnd:HWND; Msg:UINT; wParam:WPARAM; lParam:LPARAM):WINBOOL; +function PeekMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax, wRemoveMsg: UINT): WINBOOL; +function DispatchMessage(const lpMsg: TMsg): Longint; +function GetMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT): WINBOOL; +function SetEvent(hEvent:THevent):WINBOOL; +function CreateEvent(lpEventAttributes:PSECURITYATTRIBUTES; bManualReset:WINBOOL; bInitialState:WINBOOL; lpName:pchar):tHevent; +function terminatethread(threadhandle : tthreadid;dummy:integer) : boolean; +function waitforsingleevent(event:thevent;timeout:cardinal) : twaitresult; +function SetTimer(ahWnd:HWND; nIDEvent:taddrint; uElapse:UINT; lpTimerFunc:tTIMERPROC):UINT; +function KillTimer(ahWnd:HWND; uIDEvent:taddrint):WINBOOL; + +procedure init; + +implementation +uses + baseunix,unix,lcore;//,safewriteln; +{$i unixstuff.inc} + +type + tmessageintransit = class + msg : tmsg; + next : tmessageintransit; + end; + + tthreaddata = class + messagequeue : tmessageintransit; + messageevent : teventobject; + waiting : boolean; + lcorethread : boolean; + nexttimer : ttimeval; + threadid : integer; + end; + twindow=class + hwnd : hwnd; + extrawindowmemory : pointer; + threadid : tthreadid; + windowproc : twndproc; + end; + +var + structurelock : tcriticalsection; + threaddata : thashtable; + windowclasses : thashtable; + lcorelinkpipesend : integer; + lcorelinkpiperecv : tlasio; + windows : thashtable; + //I would rather things crash immediately + //if they use an insufficiant size type + //than crash after over four billion + //windows have been made ;) + nextwindowhandle : qword = $100000000; +{$i ltimevalstuff.inc} + +//findthreaddata should only be called while holding the structurelock +function findthreaddata(threadid : integer) : tthreaddata; +begin + result := tthreaddata(findtree(@threaddata,inttostr(threadid))); + if result = nil then begin + result := tthreaddata.create; + result.messageevent := teventobject.create(nil,false,false,inttostr(taddrint(result))); + result.nexttimer := tv_invalidtimebig; + result.threadid := threadid; + addtree(@threaddata,inttostr(threadid),result); + end; +end; + +//deletethreaddataifunused should only be called while holding the structurelock +procedure deletethreaddataifunused(athreaddata : tthreaddata); +begin + //writeln('in deletethreaddataifunused'); + if (athreaddata <> nil) then if (athreaddata.waiting=false) and (athreaddata.messagequeue=nil) and (athreaddata.lcorethread=false) and (athreaddata.nexttimer.tv_sec=tv_invalidtimebig.tv_sec) and (athreaddata.nexttimer.tv_usec=tv_invalidtimebig.tv_usec) then begin + //writeln('threaddata is unused, freeing messageevent'); + athreaddata.messageevent.free; + //writeln('freeing thread data object'); + athreaddata.free; + //writeln('deleting thread data object from hashtable'); + deltree(@threaddata,inttostr(athreaddata.threadid)); + //writeln('finished deleting thread data'); + end else begin + //writeln('thread data is not unused'); + end; +end; + +function getwindowlongptr(ahwnd:hwnd;nindex:integer) : taddrint; +var + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window <> nil then begin + result := paddrint(taddrint(window.extrawindowmemory)+nindex)^; + end else begin + result := 0; + end; + finally + structurelock.release; + end; +end; + +function setwindowlongptr(ahwnd:hwnd;nindex:integer;dwNewLong : taddrint) : taddrint; +var + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window <> nil then begin + result := paddrint(taddrint(window.extrawindowmemory)+nindex)^; + paddrint(taddrint(window.extrawindowmemory)+nindex)^ := dwnewlong; + end else begin + result := 0; + end; + finally + structurelock.release; + end; + +end; + + +function DefWindowProc(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; +begin + result := 0; +end; + +function strdup(s:pchar) : pchar; +begin + //swriteln('in strdup, about to allocate memory'); + result := getmem(strlen(s)+1); + //swriteln('about to copy string'); + strcopy(s,result); + //swriteln('leaving strdup'); +end; + +function RegisterClass(const lpWndClass:TWNDCLASS):ATOM; +var + storedwindowclass:pwndclass; +begin + structurelock.acquire; + try + //swriteln('in registerclass, about to check for duplicate window class'); + storedwindowclass := findtree(@windowclasses, lpwndclass.lpszclassname); + if storedwindowclass <> nil then begin + + if comparebyte(storedwindowclass^,lpwndclass,sizeof(twndclass)-sizeof(pchar)-sizeof(pchar)) <> 0 then begin + //swriteln('duplicate window class registered with different settings'); + raise exception.create('duplicate window class registered with different settings'); + end else begin + //swriteln('duplicate window class registered with same settings, tollerated'); + end; + end else begin + //swriteln('about to allocate memory for new windowclass'); + storedwindowclass := getmem(sizeof(twndclass)); + //swriteln('about to copy windowclass from parameter'); + move(lpwndclass,storedwindowclass^,sizeof(twndclass)); + //swriteln('about to copy strings'); + if lpwndclass.lpszmenuname <> nil then storedwindowclass.lpszmenuname := strdup(lpwndclass.lpszmenuname); + if lpwndclass.lpszclassname <> nil then storedwindowclass.lpszclassname := strdup(lpwndclass.lpszclassname); + //swriteln('about to add result to list of windowclasses'); + addtree(@windowclasses,lpwndclass.lpszclassname,storedwindowclass); + end; + //swriteln('about to return result'); + result := storedwindowclass; + //swriteln('leaving registerclass'); + finally + structurelock.release; + end; +end; + +function CreateWindowEx(dwExStyle:DWORD; lpClassName:LPCSTR; lpWindowName:LPCSTR; dwStyle:DWORD; X:longint;Y:longint; nWidth:longint; nHeight:longint; hWndParent:HWND; hMenu:HMENU;hInstance:HINST; lpParam:LPVOID):HWND; +var + wndclass : pwndclass; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := twindow.create; + window.hwnd := nextwindowhandle; + result := window.hwnd; + nextwindowhandle := nextwindowhandle + 1; + addtree(@windows,inttostr(window.hwnd),window); + wndclass := findtree(@windowclasses,lpclassname); + window.extrawindowmemory := getmem(wndclass.cbwndextra); + + getthreadmanager(tm); + window.threadid := tm.GetCurrentThreadId; + window.windowproc := wndclass.lpfnwndproc; + finally + structurelock.release; + end; +end; +function DestroyWindow(ahWnd:HWND):WINBOOL; +var + window : twindow; + windowthreaddata : tthreaddata; + currentmessage : tmessageintransit; + prevmessage : tmessageintransit; +begin + //writeln('started to destroy window'); + structurelock.acquire; + try + window := twindow(findtree(@windows,inttostr(ahwnd))); + if window <> nil then begin + freemem(window.extrawindowmemory); + //writeln('aboute to delete window from windows structure'); + deltree(@windows,inttostr(ahwnd)); + //writeln('deleted window from windows structure'); + windowthreaddata := tthreaddata(findtree(@threaddata,inttostr(window.threadid))); + + if windowthreaddata <> nil then begin + //writeln('found thread data scanning for messages to clean up'); + currentmessage := windowthreaddata.messagequeue; + prevmessage := nil; + while currentmessage <> nil do begin + while (currentmessage <> nil) and (currentmessage.msg.hwnd = ahwnd) do begin + if prevmessage = nil then begin + windowthreaddata.messagequeue := currentmessage.next; + end else begin + prevmessage.next := currentmessage.next; + end; + currentmessage.free; + if prevmessage = nil then begin + currentmessage := windowthreaddata.messagequeue; + end else begin + currentmessage := prevmessage.next; + end; + end; + if currentmessage <> nil then begin + prevmessage := currentmessage; + currentmessage := currentmessage.next; + end; + end; + //writeln('deleting thread data structure if it is unused'); + deletethreaddataifunused(windowthreaddata); + end else begin + //writeln('there is no thread data to search for messages to cleanup'); + end; + //writeln('freeing window'); + window.free; + result := true; + end else begin + result := false; + end; + finally + structurelock.release; + end; + //writeln('window destroyed'); +end; + + + +function PostMessage(hWnd:HWND; Msg:UINT; wParam:WPARAM; lParam:LPARAM):WINBOOL; +var + threaddata : tthreaddata; + message : tmessageintransit; + messagequeueend : tmessageintransit; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(hwnd)); + if window <> nil then begin + threaddata := findthreaddata(window.threadid); + message := tmessageintransit.create; + message.msg.hwnd := hwnd; + message.msg.message := msg; + message.msg.wparam := wparam; + message.msg.lparam := lparam; + if threaddata.lcorethread then begin + //swriteln('posting message to lcore thread'); + fdwrite(lcorelinkpipesend,message,sizeof(message)); + end else begin + //writeln('posting message to non lcore thread'); + if threaddata.messagequeue = nil then begin + threaddata.messagequeue := message; + end else begin + messagequeueend := threaddata.messagequeue; + while messagequeueend.next <> nil do begin + messagequeueend := messagequeueend.next; + end; + messagequeueend.next := message; + end; + + //writeln('message added to queue'); + if threaddata.waiting then threaddata.messageevent.setevent; + end; + result := true; + end else begin + result := false; + end; + finally + structurelock.release; + end; + +end; + +function gettickcount : dword; +var + result64: integer; + tv : ttimeval; +begin + gettimeofday(tv); + result64 := (tv.tv_sec*1000)+(tv.tv_usec div 1000); + result := result64; +end; + +function DispatchMessage(const lpMsg: TMsg): Longint; +var + timerproc : ttimerproc; + window : twindow; + windowproc : twndproc; +begin + ////swriteln('in dispatchmessage, msg.hwnd='+inttohex(taddrint(lpmsg.hwnd),16)); + if (lpmsg.lparam <> 0) and (lpmsg.message = WM_TIMER) then begin + timerproc := ttimerproc(lpmsg.lparam); + timerproc(lpmsg.hwnd,lpmsg.message,lpmsg.wparam,gettickcount); + result := 0; + end else begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(lpmsg.hwnd)); + //we have to get the window procedure while the structurelock + //is still held as the window could be destroyed from another thread + //otherwise. + windowproc := window.windowproc; + finally + structurelock.release; + end; + if window <> nil then begin + result := windowproc(lpmsg.hwnd,lpmsg.message,lpmsg.wparam,lpmsg.lparam); + end else begin + result := -1; + end; + end; +end; + +procedure processtimers; +begin +end; + +function GetMessageinternal(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT; wremovemsg : UINT;peek:boolean): WINBOOL; +var + tm : tthreadmanager; + threaddata : tthreaddata; + message : tmessageintransit; + nowtv : ttimeval; + timeouttv : ttimeval; + timeoutms : int64; + +begin + if hwnd <> 0 then raise exception.create('getting messages for an individual window is not supported'); + if (wmsgfiltermin <> 0) or (wmsgfiltermax <> 0) then raise exception.create('message filtering is not supported'); + structurelock.acquire; + result := true; + try + getthreadmanager(tm); + threaddata := findthreaddata(tm.GetCurrentThreadId); + if threaddata.lcorethread then raise exception.create('get/peek message cannot be used in the lcore thread'); + message := threaddata.messagequeue; + gettimeofday(nowtv); + while (not peek) and (message=nil) and (not tv_compare(nowtv,threaddata.nexttimer)) do begin + threaddata.waiting := true; + structurelock.release; + if (threaddata.nexttimer.tv_sec = TV_invalidtimebig.tv_sec) and (threaddata.nexttimer.tv_usec = TV_invalidtimebig.tv_usec) then begin + threaddata.messageevent.waitfor(INFINITE); + end else begin + + timeouttv := threaddata.nexttimer; + timeoutms := (timeouttv.tv_sec * 1000)+(timeouttv.tv_usec div 1000); + //i'm assuming the timeout is in milliseconds + if (timeoutms > maxlongint) then timeoutms := maxlongint; + threaddata.messageevent.waitfor(timeoutms); + + end; + structurelock.acquire; + threaddata.waiting := false; + message := threaddata.messagequeue; + gettimeofday(nowtv); + end; + if (message=nil) and tv_compare(nowtv,threaddata.nexttimer) then begin + processtimers; + end; + message := threaddata.messagequeue; + if message <> nil then begin + lpmsg := message.msg; + if wremovemsg=PM_REMOVE then begin + threaddata.messagequeue := message.next; + message.free; + end; + end else begin + result :=false; + end; + deletethreaddataifunused(threaddata); + finally + structurelock.release; + end; +end; + +function GetMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT): WINBOOL; +begin + result := getmessageinternal(lpmsg,hwnd,wmsgfiltermin,wmsgfiltermax,PM_REMOVE,false); +end; + +function PeekMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax, wRemoveMsg: UINT): WINBOOL; +begin + result := getmessageinternal(lpmsg,hwnd,wmsgfiltermin,wmsgfiltermax,PM_REMOVE,true); +end; + +function SetEvent(hEvent:THevent):WINBOOL; +begin + hevent.setevent; + result := true; +end; + +function CreateEvent(lpEventAttributes:PSECURITYATTRIBUTES; bManualReset:WINBOOL; bInitialState:WINBOOL; lpName:pchar):tHevent; +begin + result := teventobject.create(lpeventattributes,bmanualreset,binitialstate,lpname); +end; + +function terminatethread(threadhandle:tthreadid;dummy : integer) : boolean; +var + tm : tthreadmanager; +begin + getthreadmanager(tm); + tm.killthread(threadhandle); + result := true; +end; + +function waitforsingleevent(event:thevent;timeout:cardinal) : twaitresult; +begin + result := event.waitfor(timeout); +end; + +procedure removefrombuffer(n : integer; var buffer:string); +begin + if n=length(buffer) then begin + buffer := ''; + end else begin + uniquestring(buffer); + move(buffer[n+1],buffer[1],length(buffer)-n); + setlength(buffer,length(buffer)-n); + end; +end; + +type + tsc=class + procedure available(sender:tobject;error:word); + end; + +var + recvbuf : string; + +procedure tsc.available(sender:tobject;error:word); +var + message : tmessageintransit; + messagebytes : array[1..sizeof(tmessageintransit)] of char absolute message; + i : integer; +begin + //swriteln('received data on lcorelinkpipe'); + recvbuf := recvbuf + lcorelinkpiperecv.receivestr; + while length(recvbuf) >= sizeof(tmessageintransit) do begin + for i := 1 to sizeof(tmessageintransit) do begin + messagebytes[i] := recvbuf[i]; + end; + dispatchmessage(message.msg); + message.free; + removefrombuffer(sizeof(tmessageintransit),recvbuf); + end; +end; + +procedure init; +var + tm : tthreadmanager; + threaddata : tthreaddata; + pipeends : tfildes; + sc : tsc; +begin + structurelock := tcriticalsection.create; + getthreadmanager(tm); + threaddata := findthreaddata(tm.GetCurrentThreadId); + threaddata.lcorethread := true; + fppipe(pipeends); + lcorelinkpipesend := pipeends[1]; + lcorelinkpiperecv := tlasio.create(nil); + lcorelinkpiperecv.dup(pipeends[0]); + lcorelinkpiperecv.ondataavailable := sc.available; + recvbuf := ''; +end; + +var + lcorethreadtimers : thashtable; +type + tltimerformsg = class(tltimer) + public + hwnd : hwnd; + id : taddrint; + procedure timer(sender : tobject); + end; + +procedure tltimerformsg.timer(sender : tobject); +var + msg : tmsg; +begin + ////swriteln('in tltimerformsg.timer'); + fillchar(msg,sizeof(msg),0); + msg.message := WM_TIMER; + msg.hwnd := hwnd; + msg.wparam := ID; + msg.lparam := 0; + dispatchmessage(msg); +end; + +function SetTimer(ahWnd:HWND; nIDEvent:taddrint; uElapse:UINT; lpTimerFunc:tTIMERPROC):UINT; +var + threaddata : tthreaddata; + ltimer : tltimerformsg; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window= nil then raise exception.create('invalid window'); + threaddata := findthreaddata(window.threadid); + finally + structurelock.release; + end; + if threaddata.lcorethread then begin + getthreadmanager(tm); + if tm.GetCurrentThreadId <> window.threadid then raise exception.create('timers on the lcore thread may only be added and removed from the lcore thread'); + if ahwnd = 0 then raise exception.create('timers on the lcore thread must be associated with a window handle'); + if @lptimerfunc <> nil then raise exception.create('seperate timer functions are not supported'); + + //remove preexisting timer with same ID + killtimer(ahwnd,nIDEvent); + + ltimer := tltimerformsg.create(nil); + ltimer.interval := uelapse; + ltimer.id := nidevent; + ltimer.hwnd := ahwnd; + ltimer.enabled := true; + ltimer.ontimer := ltimer.timer; + + addtree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(nIDEvent),ltimer); + + result := nidevent; + end else begin + raise exception.create('settimer not implemented for threads other than the lcore thread'); + end; +end; + +function KillTimer(ahWnd:HWND; uIDEvent:taddrint):WINBOOL; +var + threaddata : tthreaddata; + ltimer : tltimerformsg; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window= nil then raise exception.create('invalid window'); + threaddata := findthreaddata(window.threadid); + finally + structurelock.release; + end; + if threaddata.lcorethread then begin + getthreadmanager(tm); + if tm.GetCurrentThreadId <> window.threadid then raise exception.create('timers on the lcore thread may only be added and remove from the lcore thread'); + if ahwnd = 0 then raise exception.create('timers on the lcore thread must be associated with a window handle'); + ltimer := tltimerformsg(findtree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(uIDEvent))); + if ltimer <> nil then begin + deltree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(uIDEvent)); + ltimer.free; + result := true; + end else begin + result := false; + end; + end else begin + raise exception.create('settimer not implemented for threads other than the lcore thread'); + end; +end; + +end. \ No newline at end of file diff --git a/httpserver_20080306/lsignal.pas b/httpserver_20080306/lsignal.pas new file mode 100755 index 0000000..573fe28 --- /dev/null +++ b/httpserver_20080306/lsignal.pas @@ -0,0 +1,198 @@ +{lsocket.pas} + +{signal code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit lsignal; +{$mode delphi} +interface + uses sysutils, + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix, + {$endif} + classes,lcore,lloopback; + + type + tsignalevent=procedure(sender:tobject;signal:integer) of object; + tlsignal=class(tcomponent) + public + onsignal : tsignalevent ; + prevsignal : tlsignal ; + nextsignal : tlsignal ; + + constructor create(aowner:tcomponent);override; + destructor destroy;override; + end; + + + procedure starthandlesignal(signal:integer); + +var + firstsignal : tlsignal; + blockset : sigset; + signalloopback : tlloopback ; + +implementation +{$include unixstuff.inc} + +constructor tlsignal.create; +begin + inherited create(AOwner); + nextsignal := firstsignal; + prevsignal := nil; + + if assigned(nextsignal) then nextsignal.prevsignal := self; + firstsignal := self; + + //interval := 1000; + //enabled := true; + //released := false; +end; + +destructor tlsignal.destroy; +begin + if prevsignal <> nil then begin + prevsignal.nextsignal := nextsignal; + end else begin + firstsignal := nextsignal; + end; + if nextsignal <> nil then begin + nextsignal.prevsignal := prevsignal; + end; + inherited destroy; +end; +{$ifdef linux} + {$ifdef ver1_9_8} + {$define needsignalworkaround} + {$endif} + {$ifdef ver2_0_0} + {$define needsignalworkaround} + {$endif} + {$ifdef ver2_0_2} + {$define needsignalworkaround} + {$endif} +{$endif} +{$ifdef needsignalworkaround} + //using the 1.9.6 version of this stuff because the 1.9.8 and 2.0.0 versions seem broken + type + TSysParam = Longint; + TSysResult = longint; + const + syscall_nr_sigaction = 67; + //function Do_SysCall(sysnr:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL0'; + //function Do_SysCall(sysnr,param1:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL1'; + //function Do_SysCall(sysnr,param1,param2:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL2'; + function Do_SysCall(sysnr,param1,param2,param3:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL3'; + //function Do_SysCall(sysnr,param1,param2,param3,param4:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL4'; + //function Do_SysCall(sysnr,param1,param2,param3,param4,param5:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL5'; + + function Fpsigaction(sig: cint; act : psigactionrec; oact : psigactionrec): cint;// [public, alias : 'FPC_SYSC_SIGACTION']; + { + Change action of process upon receipt of a signal. + Signum specifies the signal (all except SigKill and SigStop). + If Act is non-nil, it is used to specify the new action. + If OldAct is non-nil the previous action is saved there. + } + begin + //writeln('fucking'); + {$ifdef RTSIGACTION} + {$ifdef cpusparc} + { Sparc has an extra stub parameter } + Fpsigaction:=do_syscall(syscall_nr_rt_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact),TSysParam(PtrInt(@Fprt_sigreturn_stub)-8),TSysParam(8)); + {$else cpusparc} + Fpsigaction:=do_syscall(syscall_nr_rt_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact),TSysParam(8)); + {$endif cpusparc} + {$else RTSIGACTION} + //writeln('nice'); + Fpsigaction:=do_syscall(syscall_nr_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact)); + {$endif RTSIGACTION} + end; +{$endif} + +// cdecl procedures are not name mangled +// so USING something unlikely to cause colliesions in the global namespace +// is a good idea +procedure lsignal_handler( Sig : Integer);cdecl; +var + currentsignal : tlsignal; +begin +// writeln('in lsignal_hanler'); + currentsignal := firstsignal; + while assigned(currentsignal) do begin + if assigned(currentsignal.onsignal) then currentsignal.onsignal(currentsignal,sig); + currentsignal := currentsignal.nextsignal; + + end; +// writeln('about to send down signalloopback'); + if assigned(signalloopback) then begin + signalloopback.sendstr(' '); + end; +// writeln('left lsignal_hanler'); +end; + +{$ifdef freebsd} + +{$if (FPC_VERSION > 2) or ((FPC_VERSION = 2) and (FPC_RELEASE >= 2))} +procedure lsignal_handler2(signal:longint;info:PSigInfo;context:psigcontext); cdecl; +{$else} +procedure lsignal_handler2(signal:longint;var info:TSigInfo_t;var context:SigContextRec); cdecl; +{$endif} + +begin + lsignal_handler(signal); +end; +{$endif} + + +const + allbitsset=-1; + {$ifdef ver1_0} + saction : sigactionrec = (handler:(sh:lsignal_handler);sa_flags:0); + {$else} + {$ifdef darwin} + saction : sigactionrec = (sa_handler:tsigaction(lsignal_handler);sa_flags:0); + {$else} + {$ifdef freebsd} + //version number is FPC_VERSION.FPC_RELEASE.FPC_PATCH + {$if (FPC_VERSION>2) or ((FPC_VERSION=2) and (FPC_RELEASE>0)) or ((FPC_VERSION=2) and (fpc_release=0) and (fpc_patch>=2))} + saction : sigactionrec = (sa_handler:lsignal_handler2;sa_flags:0); + {$else} + saction : sigactionrec = (sa_handler:tsigaction(lsignal_handler);sa_flags:0); + {$endif} + + {$else} + {$ifdef ver1_9_2} + saction : sigactionrec = (handler:(sh:lsignal_handler);sa_flags:0); + {$else} + //version number is FPC_VERSION.FPC_RELEASE.FPC_PATCH + {$if (FPC_VERSION>2) or ((FPC_VERSION=2) and (FPC_RELEASE>0)) or ((FPC_VERSION=2) and (fpc_release=0) and (fpc_patch>=2))} + saction : sigactionrec = (sa_handler:{$ifndef ver1_9_6}{$ifndef ver1_9_6}{$ifndef ver1_0}SigActionHandler{$endif}{$endif}{$endif}(lsignal_handler);sa_flags:0;sa_restorer:nil); + {$else} + saction : sigactionrec = (sa_handler:{$ifndef ver1_9_6}{$ifndef ver1_9_6}{$ifndef ver1_0}SigActionHandler{$endif}{$endif}{$endif}(lsignal_handler)); + {$endif} + {$endif} + {$endif} + {$endif} + {$endif} +procedure starthandlesignal(signal:integer); +begin + if signal in ([0..31]-[sigkill,sigstop]) then begin + sigprocmask(SIG_BLOCK,@blockset,nil); + sigaction(signal,@saction,nil) + end else begin + raise exception.create('invalid signal number') + end; +end; + +initialization + fillchar(blockset,sizeof(blockset),0); + blockset[0] := $FFFFFFFF - (1 shl sigstop) - (1 shl sigkill) - (1 shl sigsegv); + saction.sa_mask := blockset; + +end. diff --git a/httpserver_20080306/lsocket.pas b/httpserver_20080306/lsocket.pas new file mode 100755 index 0000000..617f153 --- /dev/null +++ b/httpserver_20080306/lsocket.pas @@ -0,0 +1,706 @@ +{lsocket.pas} + +{socket code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +{ +changes by plugwash (20030728) +* created handlefdtrigger virtual method in tlasio (overridden in tlsocket) and moved a lot of code from messageloop into it +* changed tlasio to tlasio +* split fdhandle into fdhandlein and fdhandleout +* i now use fdsrmaster and fdswmaster instead of rebuilding the lists every loop +* split lsocket.pas into lsocket.pas and lcore.pas + + +changes by beware (20030903) +* added getxaddr, getxport (local addr, port, as string) +* added getpeername, remote addr+port as binary +* added htons and htonl functions (endian swap, same interface as windows API) + +beware (20030905) +* if connect failed (conn refused) set state to connected and call internalclose, to get closed handler (instead of fdclose) +* (lcore) if closing the fd's in internalcose, set fd's to -1 because closing an fd makes it invalid + +beware (20030927) +* fixed: on connect failed, tried to close fdhandle's which were already set to -1, added check + +beware (20031017) +* added getpeeraddr, getpeerport, remote addr+port as string +} + + +unit lsocket; +{$ifdef fpc} + {$mode delphi} +{$endif} +interface + uses + sysutils, + {$ifdef win32} + windows,winsock, + {$else} + + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix, + {$endif} + sockets, + {$endif} + classes,{pgdebugout,}pgtypes,lcore,fd_utils,binipstuff,dnssync; +type + sunB = packed record + s_b1, s_b2, s_b3, s_b4: byte; + end; + + SunW = packed record + s_w1, s_w2: word; + end; + + TInAddr = packed record + case integer of + 0: (S_un_b: SunB); + 1: (S_un_w: SunW); + 2: (S_addr: cardinal); + end; + {$ifdef ipv6} + {$ifdef ver1_0} + cuint16=word; + cuint32=dword; + sa_family_t=word; + + + TInetSockAddr6 = packed Record + sin6_family : sa_family_t; + sin6_port : cuint16; + sin6_flowinfo : cuint32; + sin6_addr : Tin6_addr; + sin6_scope_id : cuint32; + end; + {$endif} + {$endif} + TinetSockAddrv = packed record + case integer of + 0: (InAddr:TInetSockAddr); + {$ifdef ipv6} + 1: (InAddr6:TInetSockAddr6); + {$endif} + end; + Pinetsockaddrv = ^Tinetsockaddrv; + + + type + tsockaddrin=TInetSockAddr; + + type + TLsocket = class(tlasio) + public + //a: string; + + inAddr : TInetSockAddrV; +{ inAddrSize:integer;} + + //host : THostentry ; + + //mainthread : boolean ; //for debuggin only + addr:string; + port:string; + localaddr:string; + localport:string; + proto:string; + udp:boolean; + listenqueue:integer; + function getaddrsize:integer; + procedure connect; virtual; + procedure bindsocket; + procedure listen; + function accept : longint; + function sendto(dest:TInetSockAddr;destlen:integer;data:pointer;len:integer):integer; virtual; + function receivefrom(data:pointer;len:integer;var src:TInetSockAddr;var srclen:integer):integer; virtual; + //procedure internalclose(error:word);override; + procedure handlefdtrigger(readtrigger,writetrigger:boolean); override; + function send(data:pointer;len:integer):integer;override; + procedure sendstr(const str : string);override; + function Receive(Buf:Pointer;BufSize:integer):integer; override; + function getpeername(var addr:tsockaddrin;addrlen:integer):integer; virtual; + procedure getXaddrbin(var binip:tbinip); virtual; + procedure getpeeraddrbin(var binip:tbinip); virtual; + function getXaddr:string; virtual; + function getpeeraddr:string; virtual; + function getXport:string; virtual; + function getpeerport:string; virtual; + constructor Create(AOwner: TComponent); override; + {$ifdef win32} + procedure myfdclose(fd : integer); override; + function myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; override; + function myfdread(fd: LongInt;var buf;size: LongInt):LongInt; override; + {$endif} + end; + tsocket=longint; // for compatibility with twsocket + + twsocket=tlsocket; {easy} + +function htons(w:word):word; +function htonl(i:integer):integer; +{!!!function longipdns(s:string):longint;} + +{$ifdef ipv6} +const + v4listendefault:boolean=false; +{$endif} + + +const + TCP_NODELAY=1; + IPPROTO_TCP=6; + +implementation +{$include unixstuff.inc} + +function longip(s:string):longint;{$ifdef fpc}inline;{$endif} +var + l:longint; + a,b:integer; + +function convertbyte(const s:string):integer;{$ifdef fpc}inline;{$endif} +begin + result := strtointdef(s,-1); + if result < 0 then exit; + if result > 255 then exit; + + {01 exception} + if (result <> 0) and (s[1] = '0') then begin + result := -1; + exit; + end; + + {+1 exception} + if not (s[1] in ['0'..'9']) then begin + result := -1; + exit + end; +end; + +begin + result := 0; + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := b shl 24; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 16; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 8; + s := copy(s,a+1,256); + b := convertbyte(copy(s,1,256));if (b < 0) then exit; + l := l or b; + result := l; +end; + +(*!!! +function longipdns(s:string):longint; +var + host : thostentry; +begin + if s = '0.0.0.0' then begin + result := 0; + end else begin + result := longip(s); + if result = 0 then begin + if gethostbyname(s,host) then begin; + result := htonl(Longint(Host.Addr)); + end; + //writeln(inttohex(longint(host.addr),8)) + end; + if result = 0 then begin + if resolvehostbyname(s,host) then begin; + result := htonl(Longint(Host.Addr)); + end; + //writeln(inttohex(longint(host.addr),8)) + end; + end; +end; +*) + + +function htons(w:word):word; +begin + {$ifndef ENDIAN_BIG} + result := ((w and $ff00) shr 8) or ((w and $ff) shl 8); + {$else} + result := w; + {$endif} +end; + +function htonl(i:integer):integer; +begin + {$ifndef ENDIAN_BIG} + result := (i shr 24) or (i shr 8 and $ff00) or (i shl 8 and $ff0000) or (i shl 24 and $ff000000); + {$else} + result := i; + {$endif} +end; + +function tlsocket.getaddrsize:integer; +begin + {$ifdef ipv6} + if inaddr.inaddr.family = AF_INET6 then result := sizeof(tinetsockaddr6) else + {$endif} + result := sizeof(tinetsockaddr); +end; + +function makeinaddrv(addr,port:string;var inaddr:tinetsockaddrv):integer; +var + biniptemp:tbinip; +begin + result := 0; + biniptemp := forwardlookup(addr,10); + fillchar(inaddr,sizeof(inaddr),0); + //writeln('converted address '+addr+' to binip '+ipbintostr(biniptemp)); + if biniptemp.family = AF_INET then begin + inAddr.InAddr.family:=AF_INET; + inAddr.InAddr.port:=htons(strtointdef(port,0)); + inAddr.InAddr.addr:=biniptemp.ip; + result := sizeof(tinetsockaddr); + end else + {$ifdef ipv6} + if biniptemp.family = AF_INET6 then begin + inAddr.InAddr6.sin6_family:=AF_INET6; + inAddr.InAddr6.sin6_port:=htons(strtointdef(port,0)); + inAddr.InAddr6.sin6_addr:=biniptemp.ip6; + result := sizeof(tinetsockaddr6); + end else + {$endif} + raise esocketexception.create('unable to resolve address: '+addr); +end; + +procedure tlsocket.connect; +var + a:integer; +begin + if state <> wsclosed then close; + //prevtime := 0; + makeinaddrv(addr,port,inaddr); + + udp := uppercase(proto) = 'UDP'; + if udp then a := SOCK_DGRAM else a := SOCK_STREAM; + a := Socket(inaddr.inaddr.family,a,0); + + //writeln(ord(inaddr.inaddr.family)); + if a = -1 then begin + lasterror := {$ifdef win32}getlasterror{$else}socketerror{$endif}; + raise esocketexception.create('unable to create socket'); + end; + try + dup(a); + bindsocket; + if udp then begin + {$ifndef win32} + SetSocketOptions(fdhandleout, SOL_SOCKET, SO_BROADCAST, 'TRUE', Length('TRUE')); + {$endif} + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + end else begin + state :=wsconnecting; + {$ifdef win32} + //writeln(inaddr.inaddr.port); + winsock.Connect(fdhandlein,winsock.psockaddr(@inADDR)^,getaddrsize); + {$else} + sockets.Connect(fdhandlein,inADDR,getaddrsize); + {$endif} + end; + eventcore.rmasterset(fdhandlein,false); + if udp then begin + eventcore.wmasterclr(fdhandleout); + end else begin + eventcore.wmasterset(fdhandleout); + end; + //sendq := ''; + except + on e: exception do begin + fdcleanup; + raise; //reraise the exception + end; + end; +end; + +procedure tlsocket.sendstr(const str : string); +begin + if udp then begin + send(@str[1],length(str)) + end else begin + inherited sendstr(str); + end; +end; + +function tlsocket.send(data:pointer;len:integer):integer; +begin + if udp then begin + //writeln('sending to '+inttohex(inaddr.inaddr.addr,8)); + result := sendto(inaddr.inaddr,getaddrsize,data,len) +; + //writeln('send result',result); + //writeln('errno',errno); + end else begin + result := inherited send(data,len); + end; +end; + + +function tlsocket.receive(Buf:Pointer;BufSize:integer):integer; +begin + if udp then begin + result := myfdread(self.fdhandlein,buf^,bufsize); + end else begin + result := inherited receive(buf,bufsize); + end; +end; + +procedure tlsocket.bindsocket; +var + a:integer; + inAddrtemp:TInetSockAddrV; + inAddrtempx:{$ifdef win32}winsock.TSockaddr{$else}TInetSockAddrV{$endif} absolute inaddrtemp; + inaddrtempsize:integer; +begin + try + if (localaddr <> '') or (localport <> '') then begin + if localaddr = '' then begin + {$ifdef ipv6} + if inaddr.inaddr.family = AF_INET6 then localaddr := '::' else + {$endif} + localaddr := '0.0.0.0'; + end; + //gethostbyname(localaddr,host); + + inaddrtempsize := makeinaddrv(localaddr,localport,inaddrtemp); + + If Bind(fdhandlein,inaddrtempx,inaddrtempsize)<> {$ifdef win32}0{$else}true{$endif} Then begin + state := wsclosed; + lasterror := {$ifdef win32}getlasterror{$else}socketerror{$endif}; + raise ESocketException.create('unable to bind, error '+inttostr(lasterror)); + end; + state := wsbound; + end; + except + on e: exception do begin + fdcleanup; + raise; //reraise the exception + end; + end; +end; + +procedure tlsocket.listen; +var + yes:longint; + socktype:integer; + biniptemp:tbinip; + origaddr:string; +begin + if state <> wsclosed then close; + udp := uppercase(proto) = 'UDP'; + if udp then socktype := SOCK_DGRAM else socktype := SOCK_STREAM; + origaddr := addr; + + if addr = '' then begin + {$ifdef ipv6} + if not v4listendefault then begin + addr := '::'; + end else + {$endif} + addr := '0.0.0.0'; + end; + biniptemp := forwardlookup(addr,10); + addr := ipbintostr(biniptemp); + fdhandlein := socket(biniptemp.family,socktype,0); + {$ifdef ipv6} + if (addr = '::') and (origaddr = '') and (fdhandlein < 0) then begin + addr := '0.0.0.0'; + fdhandlein := socket(AF_INET,socktype,0); + end; + {$endif} + if fdhandlein = -1 then raise ESocketException.create('unable to create socket'); + dupnowatch(fdhandlein); // sets up maxs and copies handle to fdhandleout among other things + //eventcore.setfdreverse(fdhandlein,self); //already taken care of by dup + state := wsclosed; // then set this back as it was an undesired side effect of dup + + try + yes := $01010101; {Copied this from existing code. Value is empiric, + but works. (yes=true<>0) } + {$ifndef win32} + if SetSocketOptions(fdhandlein, SOL_SOCKET, SO_REUSEADDR,yes,sizeof(yes))=-1 then begin + raise ESocketException.create('unable to set socket options'); + end; + {$endif} + localaddr := addr; + localport := port; + bindsocket; + + if not udp then begin + {!!! allow custom queue length? default 5} + if listenqueue = 0 then listenqueue := 5; + If {$ifdef win32}winsock{$else}sockets{$endif}.Listen(fdhandlein,listenqueue)<>{$ifdef win32}0{$else}true{$endif} Then raise esocketexception.create('unable to listen'); + state := wsListening; + end else begin + {$ifndef win32} + SetSocketOptions(fdhandleout, SOL_SOCKET, SO_BROADCAST, 'TRUE', Length('TRUE')); + {$endif} + state := wsconnected; + end; + finally + if state = wsclosed then begin + if fdhandlein >= 0 then begin + {one *can* get here without fd -beware} + eventcore.rmasterclr(fdhandlein); + myfdclose(fdhandlein); // we musnt leak file discriptors + eventcore.setfdreverse(fdhandlein,nil); + fdhandlein := -1; + end; + end else begin + eventcore.rmasterset(fdhandlein,true); + end; + if fdhandleout >= 0 then eventcore.wmasterclr(fdhandleout); + end; + //writeln('listened on addr '+addr+':'+port+' '+proto+' using socket number ',fdhandlein); +end; + +function tlsocket.accept : longint; +var + FromAddrSize : LongInt; // i don't realy know what to do with these at this + FromAddr : TInetSockAddrV; // at this point time will tell :) +begin + + FromAddrSize := Sizeof(FromAddr); + {$ifdef win32} + result := winsock.accept(fdhandlein,@fromaddr,@fromaddrsize); + {$else} + result := sockets.accept(fdhandlein,fromaddr,fromaddrsize); + {$endif} + //now we have accepted one request start monitoring for more again + eventcore.rmasterset(fdhandlein,true); + + if result = -1 then raise esocketexception.create('error '+inttostr({$ifdef win32}getlasterror{$else}socketerror{$endif})+' while accepting'); + if result > absoloutemaxs then begin + myfdclose(result); + result := -1; + raise esocketexception.create('file discriptor out of range'); + end; +end; + +function tlsocket.sendto(dest:TInetSockAddr;destlen:integer;data:pointer;len:integer):integer; +var + destx : {$ifdef win32}winsock.TSockAddr{$else}TInetSockAddr{$endif} absolute dest; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.sendto(self.fdhandleout,data^,len,0,destx,destlen); +end; + +function tlsocket.receivefrom(data:pointer;len:integer;var src:TInetSockAddr;var srclen:integer):integer; +var + srcx : {$ifdef win32}winsock.TSockAddr{$else}TInetSockAddr{$endif} absolute src; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.recvfrom(self.fdhandlein,data^,len,0,srcx,srclen); +end; + +procedure tlsocket.handlefdtrigger(readtrigger,writetrigger:boolean); +var + tempbuf:array[0..receivebufsize-1] of byte; +begin + //writeln('got a fd trigger, readtrigger=',readtrigger,' writetrigger=',writetrigger); + if (state =wslistening) and readtrigger then begin +{ debugout('listening socket triggered on read');} + eventcore.rmasterclr(fdhandlein); + if assigned(onsessionAvailable) then onsessionAvailable(self,0); + end; + if udp and readtrigger then begin + if assigned(ondataAvailable) then ondataAvailable(self,0); + {!!!test} + exit; + end; + if (state =wsconnecting) and writetrigger then begin + // code for dealing with the reults of a non-blocking connect is + // rather complex + // if just write is triggered it means connect suceeded + // if both read and write are triggered it can mean 2 things + // 1: connect ok and data availible + // 2: connect fail + // to find out which you must read from the socket and look for errors + // there if we read successfully we drop through into the code for fireing + // the read event + if not readtrigger then begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + end else begin + numread := myfdread(fdhandlein,tempbuf,sizeof(tempbuf)); + if numread <> -1 then begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + //connectread := true; + recvq.add(@tempbuf,numread); + end else begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,{$ifdef win32}wsagetlasterror{$else}linuxerror{$endif}); +{ debugout('connect fail');} + self.internalclose(0); + recvq.del(maxlongint); + end; + // if things went well here we are now in the state wsconnected with data sitting in our receive buffer + // so we drop down into the processing for data availible + end; + if fdhandlein >= 0 then begin + if state = wsconnected then begin + eventcore.rmasterset(fdhandlein,false); + end else begin + eventcore.rmasterclr(fdhandlein); + end; + end; + if fdhandleout >= 0 then begin + if sendq.size = 0 then begin + //don't clear the bit in fdswmaster if data is in the sendq + eventcore.wmasterclr(fdhandleout); + end; + end; + + end; + inherited handlefdtrigger(readtrigger,writetrigger); +end; + +constructor tlsocket.Create(AOwner: TComponent); +begin + inherited create(aowner); + closehandles := true; +end; + + +function tlsocket.getpeername(var addr:tsockaddrin;addrlen:integer):integer; +var + addrx : {$ifdef win32}winsock.tsockaddr{$else}tsockaddrin{$endif} absolute addr; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.getpeername(self.fdhandlein,addrx,addrlen); +end; + +procedure tlsocket.getxaddrbin(var binip:tbinip); +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + fillchar(addr,sizeof(addr),0); + + {$ifdef win32} + winsock.getsockname(self.fdhandlein,psockaddr(@addr)^,i); + {$else} + sockets.getsocketname(self.fdhandlein,addr,i); + {$endif} + binip.family := addr.inaddr.family; + {$ifdef ipv6} + if addr.inaddr6.sin6_family = AF_INET6 then begin + binip.ip6 := addr.inaddr6.sin6_addr; + end else + {$endif} + begin + binip.ip := addr.inaddr.addr; + end; + converttov4(binip); +end; + +procedure tlsocket.getpeeraddrbin(var binip:tbinip); +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + fillchar(addr,sizeof(addr),0); + {$ifdef win32} + winsock.getpeername(self.fdhandlein,psockaddr(@addr)^,i); + {$else} + sockets.getpeername(self.fdhandlein,addr,i); + {$endif} + + binip.family := addr.inaddr.family; + {$ifdef ipv6} + if addr.inaddr6.sin6_family = AF_INET6 then begin + binip.ip6 := addr.inaddr6.sin6_addr; + end else + {$endif} + begin + binip.ip := addr.inaddr.addr; + end; + converttov4(binip); +end; + +function tlsocket.getXaddr:string; +var + biniptemp:tbinip; +begin + getxaddrbin(biniptemp); + result := ipbintostr(biniptemp); + if result = '' then result := 'error'; +end; + +function tlsocket.getpeeraddr:string; +var + biniptemp:tbinip; +begin + getpeeraddrbin(biniptemp); + result := ipbintostr(biniptemp); + if result = '' then result := 'error'; +end; + +function tlsocket.getXport:string; +var + addr:{$ifdef win32}winsock.tsockaddr{$else}tinetsockaddr{$endif}; + i:integer; +begin + i := sizeof(addr); + {$ifdef win32} + winsock.getsockname(self.fdhandlein,addr,i); + i := htons(addr.sin_port); + {$else} + sockets.getsocketname(self.fdhandlein,addr,i); + i := htons(addr.port); + {$endif} + result := inttostr(i); +end; + +function tlsocket.getpeerport:string; +var + addr:{$ifdef win32}winsock.tsockaddr{$else}tinetsockaddr{$endif}; + i:integer; +begin + i := sizeof(addr); + {$ifdef win32} + winsock.getpeername(self.fdhandlein,addr,i); + i := htons(addr.sin_port); + {$else} + sockets.getpeername(self.fdhandlein,addr,i); + i := htons(addr.port); + {$endif} + result := inttostr(i); +end; + +{$ifdef win32} + procedure tlsocket.myfdclose(fd : integer); + begin + closesocket(fd); + end; + function tlsocket.myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; + begin + result := winsock.send(fd,(@buf)^,size,0); + end; + function tlsocket.myfdread(fd: LongInt;var buf;size: LongInt):LongInt; + begin + result := winsock.recv(fd,buf,size,0); + end; +{$endif} + +end. + diff --git a/httpserver_20080306/ltimevalstuff.inc b/httpserver_20080306/ltimevalstuff.inc new file mode 100755 index 0000000..0ac92cb --- /dev/null +++ b/httpserver_20080306/ltimevalstuff.inc @@ -0,0 +1,42 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + + + +{add nn msec to tv} +const + tv_invalidtimebig : ttimeval = (tv_sec:maxlongint;tv_usec:maxlongint); + //tv_invalidtimebig will always compare as greater than any valid timeval +procedure tv_add(var tv:ttimeval;msec:integer);//{ $ifdef fpc}inline;{ $endif} +begin + inc(tv.tv_usec,msec*1000); + inc(tv.tv_sec,tv.tv_usec div 1000000); + tv.tv_usec := tv.tv_usec mod 1000000; +end; + +{tv1 >= tv2} +function tv_compare(const tv1,tv2:ttimeval):boolean;//{ $ifdef fpc}inline;{ $endif} +begin + if tv1.tv_sec = tv2.tv_sec then begin + result := tv1.tv_usec >= tv2.tv_usec; + end else result := tv1.tv_sec > tv2.tv_sec; +end; + +procedure tv_substract(var tv:ttimeval;const tv2:ttimeval);//{ $ifdef fpc}inline;{ $endif} +begin + dec(tv.tv_usec,tv2.tv_usec); + if tv.tv_usec < 0 then begin + inc(tv.tv_usec,1000000); + dec(tv.tv_sec) + end; + dec(tv.tv_sec,tv2.tv_sec); +end; + +procedure msectotimeval(var tv:ttimeval;msec:integer); +begin + tv.tv_sec := msec div 1000; + tv.tv_usec := (msec mod 1000)*1000; +end; + diff --git a/httpserver_20080306/pgtypes.pas b/httpserver_20080306/pgtypes.pas new file mode 100755 index 0000000..3c48e26 --- /dev/null +++ b/httpserver_20080306/pgtypes.pas @@ -0,0 +1,20 @@ +{io core originally for linux bworld} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit pgtypes; +interface + type + {$ifdef cpu386}{$define i386}{$endif} + {$ifdef i386} + taddrint=longint; + {$else} + taddrint=sizeint; + {$endif} + paddrint=^taddrint; + +implementation +end. diff --git a/httpserver_20080306/uint32.inc b/httpserver_20080306/uint32.inc new file mode 100755 index 0000000..897db79 --- /dev/null +++ b/httpserver_20080306/uint32.inc @@ -0,0 +1,14 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +type + {delphi 3 and before do not have a 32 bits unsigned integer type, + but longint has the correct behavior - it doesn't on newer delphi versions} + {$ifndef fpc} + {$ifdef ver70}{$define pred4}{$endif} {tp7} + {$ifdef ver80}{$define pred4}{$endif} {delphi 1} + {$ifdef ver90}{$define pred4}{$endif} {delphi 2} + {$ifdef ver100}{$define pred4}{$endif} {delphi 3} + {$endif} + uint32={$ifdef pred4}longint{$else}longword{$endif}; diff --git a/httpserver_20080306/unixstuff.inc b/httpserver_20080306/unixstuff.inc new file mode 100755 index 0000000..92ed308 --- /dev/null +++ b/httpserver_20080306/unixstuff.inc @@ -0,0 +1,66 @@ +{$ifdef UNIX} + {$macro on} + {$ifdef VER1_0} + {$define tv_sec := sec} + {$define tv_usec := usec} + function dup(const original:integer):integer;inline; + begin + linux.dup(original,result); + end; + {$define gettimeofdaysec := gettimeofday} + {$else} + + {$define sigprocmask := fpsigprocmask} + {$define sigaction := fpsigaction} + {$define fdclose := fpclose} + {$define fcntl := fpfcntl} + {$define fdwrite := fpwrite} + {$define fdread := fpread} + {$define fdopen := fpopen} + {$define select := fpselect} + {$define linuxerror := fpgeterrno} + {$define fork := fpfork} + {$define getpid := fpgetpid} + {$define getenv := fpgetenv} + {$define chmod := fpchmod} + {$define dup2 := fpdup2} + {$ifndef ver1_9_2} + {$define flock := fpflock} + {$endif} + procedure gettimeofday(var tv:ttimeval);inline; + begin + fpgettimeofday(@tv,nil); + end; + function gettimeofdaysec : longint; + var + tv:ttimeval; + begin + gettimeofday(tv); + result := tv.tv_sec; + end; + + //a function is used here rather than a define to prevent issues with tlasio.dup + function dup(const original:integer):integer;inline; + begin + result := fpdup(original); + end; + function octal(invalue:longint):longint; + var + a : integer; + i : integer; + begin + i := 0; + result := 0; + while invalue <> 0 do begin + a := invalue mod 10; + result := result + (a shl (i*3)); + + invalue := invalue div 10; + inc(i); + end; + end; + const + sys_eintr=esyseintr; + + {$endif} +{$endif} diff --git a/httpserver_20080306/wcore.pas b/httpserver_20080306/wcore.pas new file mode 100755 index 0000000..40505ef --- /dev/null +++ b/httpserver_20080306/wcore.pas @@ -0,0 +1,372 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit wcore; + +{ +lcore compatible interface for windows + +- messageloop + +- tltimer + +} +//note: events after release are normal and are the apps responsibility to deal with safely +interface + + uses + classes,windows,mmsystem; + + type + float=double; + + tlcomponent = class(tcomponent) + public + released:boolean; + procedure release; + destructor destroy; override; + end; + + tltimer=class(tlcomponent) + public + ontimer:tnotifyevent; + initialevent:boolean; + initialdone:boolean; + prevtimer:tltimer; + nexttimer:tltimer; + interval:integer; {miliseconds, default 1000} + enabled:boolean; + nextts:integer; + constructor create(aowner:tcomponent);override; + destructor destroy;override; + end; + + ttaskevent=procedure(wparam,lparam:longint) of object; + + tltask=class(tobject) + public + handler : ttaskevent; + obj : tobject; + wparam : longint; + lparam : longint; + nexttask : tltask; + constructor create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); + end; + +procedure messageloop; +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +procedure disconnecttasks(aobj:tobject); +procedure exitmessageloop; +procedure processmessages; + +var + onshutdown:procedure(s:string); + +implementation + +uses + {$ifdef fpc} + bmessages; + {$else} + messages; + {$endif} + + +const + WINMSG_TASK=WM_USER; + +var + hwndwcore:hwnd; + firsttimer:tltimer; + timesubstract:integer; + firsttask,lasttask,currenttask:tltask; + +procedure tlcomponent.release; +begin + released := true; +end; + +destructor tlcomponent.destroy; +begin + disconnecttasks(self); + inherited destroy; +end; + +{------------------------------------------------------------------------------} + +constructor tltimer.create; +begin + inherited create(AOwner); + nexttimer := firsttimer; + prevtimer := nil; + + if assigned(nexttimer) then nexttimer.prevtimer := self; + firsttimer := self; + + interval := 1000; + enabled := true; + released := false; +end; + +destructor tltimer.destroy; +begin + if prevtimer <> nil then begin + prevtimer.nexttimer := nexttimer; + end else begin + firsttimer := nexttimer; + end; + if nexttimer <> nil then begin + nexttimer.prevtimer := prevtimer; + end; + inherited destroy; +end; + +{------------------------------------------------------------------------------} + +function wcore_timehandler:integer; +const + rollover_bits=30; +var + tv,tvnow:integer; + currenttimer,temptimer:tltimer; +begin + if not assigned(firsttimer) then begin + result := 1000; + exit; + end; + + tvnow := timegettime; + if (tvnow and ((-1) shl rollover_bits)) <> timesubstract then begin + currenttimer := firsttimer; + while assigned(currenttimer) do begin + dec(currenttimer.nextts,(1 shl rollover_bits)); + currenttimer := currenttimer.nexttimer; + end; + timesubstract := tvnow and ((-1) shl rollover_bits); + end; + tvnow := tvnow and ((1 shl rollover_bits)-1); + + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if tvnow >= currenttimer.nextts then begin + if assigned(currenttimer.ontimer) then begin + if currenttimer.enabled then begin + if currenttimer.initialevent or currenttimer.initialdone then currenttimer.ontimer(currenttimer); + currenttimer.initialdone := true; + end; + end; + currenttimer.nextts := tvnow+currenttimer.interval; + end; + temptimer := currenttimer; + currenttimer := currenttimer.nexttimer; + if temptimer.released then temptimer.free; + end; + + tv := maxlongint; + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if currenttimer.nextts < tv then tv := currenttimer.nextts; + currenttimer := currenttimer.nexttimer; + end; + result := tv-tvnow; + if result < 15 then result := 15; +end; + +{------------------------------------------------------------------------------} + +constructor tltask.create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + inherited create; + handler := ahandler; + obj := aobj; + wparam := awparam; + lparam := alparam; + {nexttask := firsttask; + firsttask := self;} + if assigned(lasttask) then begin + lasttask.nexttask := self; + end else begin + firsttask := self; + postmessage(hwndwcore,WINMSG_TASK,0,0); + end; + lasttask := self; + //ahandler(wparam,lparam); +end; + +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + tltask.create(ahandler,aobj,awparam,alparam); +end; + +procedure disconnecttasks(aobj:tobject); +var + currenttasklocal : tltask ; + counter : byte ; +begin + for counter := 0 to 1 do begin + if counter = 0 then begin + currenttasklocal := firsttask; //main list of tasks + end else begin + currenttasklocal := currenttask; //needed in case called from a task + end; + // note i don't bother to sestroy the links here as that will happen when + // the list of tasks is processed anyway + while assigned(currenttasklocal) do begin + if currenttasklocal.obj = aobj then begin + currenttasklocal.obj := nil; + currenttasklocal.handler := nil; + end; + currenttasklocal := currenttasklocal.nexttask; + end; + end; +end; + +procedure dotasks; +var + temptask:tltask; +begin + if firsttask = nil then exit; + + currenttask := firsttask; + firsttask := nil; + lasttask := nil; + while assigned(currenttask) do begin + if assigned(currenttask.handler) then currenttask.handler(currenttask.wparam,currenttask.lparam); + temptask := currenttask; + currenttask := currenttask.nexttask; + temptask.free; + end; + currenttask := nil; +end; + +{------------------------------------------------------------------------------} + +procedure exitmessageloop; +begin + postmessage(hwndwcore,WM_QUIT,0,0); +end; + + {$ifdef threadtimer} + 'thread timer' + {$else} +const timerid_wcore=$1000; + {$endif} + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + MsgRec : TMessage; + a:integer; +begin + Result := 0; // This means we handled the message + + {MsgRec.hwnd := ahWnd;} + MsgRec.wParam := awParam; + MsgRec.lParam := alParam; + + dotasks; + case auMsg of + {$ifndef threadtimer} + WM_TIMER: begin + if msgrec.wparam = timerid_wcore then begin + a := wcore_timehandler; + killtimer(hwndwcore,timerid_wcore); + settimer(hwndwcore,timerid_wcore,a,nil); + end; + end; + {$endif} + + {WINMSG_TASK:dotasks;} + + WM_CLOSE: begin + {} + end; + WM_DESTROY: begin + {} + end; + else + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; +end; + + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'wcoreClass'); + +procedure messageloop; +var + MsgRec : TMsg; +begin + + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create wcore handle, hinstance=',hinstance); + hwndwcore := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + + if hwndwcore = 0 then halt; + + {$ifdef threadtimer} + 'thread timer' + {$else} + if settimer(hwndwcore,timerid_wcore,15,nil) = 0 then halt; + {$endif} + + + while GetMessage(MsgRec, 0, 0, 0) do begin + TranslateMessage(MsgRec); + DispatchMessage(MsgRec); + {if not peekmessage(msgrec,0,0,0,PM_NOREMOVE) then onidle} + end; + + if hWndwcore <> 0 then begin + DestroyWindow(hwndwcore); + hWndwcore := 0; + end; + + {$ifdef threadtimer} + 'thread timer' + {$else} + killtimer(hwndwcore,timerid_wcore); + {$endif} +end; + +function ProcessMessage : Boolean; +var + Msg : TMsg; +begin + Result := FALSE; + if PeekMessage(Msg, hwndwcore, 0, 0, PM_REMOVE) then begin + Result := TRUE; + DispatchMessage(Msg); + end; +end; + +procedure processmessages; +begin + while processmessage do; +end; + + +end. diff --git a/lcore.pas b/lcore.pas new file mode 100755 index 0000000..900bc96 --- /dev/null +++ b/lcore.pas @@ -0,0 +1,891 @@ +{lsocket.pas} + +{io and timer code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{note: you must use the @ in the last param to tltask.create not doing so will + compile without error but will cause an access violation -pg} + +//note: events after release are normal and are the apps responsibility to deal with safely + +unit lcore; +{$ifdef fpc} + {$mode delphi} +{$endif} +{$ifdef win32} + {$define nosignal} +{$endif} +interface + uses + sysutils, + {$ifndef win32} + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, + {$endif} + fd_utils, + {$endif} + classes,pgtypes,bfifo; + procedure processtasks; + + + const + receivebufsize=1460; + + type + {$ifdef ver1_0} + sigset= array[0..31] of longint; + {$endif} + + ESocketException = class(Exception); + TBgExceptionEvent = procedure (Sender : TObject; + E : Exception; + var CanClose : Boolean) of object; + + // note : tsocketstate is defined in the same way as it is in François PIETTE's twsocket + // however tlsocket currently only uses wsClosed wsConnecting wsconnected and wsListening + TSocketState = (wsInvalidState, + wsOpened, wsBound, + wsConnecting, wsConnected, + wsAccepting, wsListening, + wsClosed); + + TWSocketOption = (wsoNoReceiveLoop, wsoTcpNoDelay); + TWSocketOptions = set of TWSocketOption; + + TSocketevent = procedure(Sender: TObject; Error: word) of object; + //Tdataavailevent = procedure(data : string); + TSendData = procedure (Sender: TObject; BytesSent: Integer) of object; + + tlcomponent = class(tcomponent) + public + released:boolean; + procedure release; virtual; + destructor destroy; override; + end; + + tlasio = class(tlcomponent) + public + state : tsocketstate ; + ComponentOptions : TWSocketOptions; + fdhandlein : Longint ; {file discriptor} + fdhandleout : Longint ; {file discriptor} + + onsessionclosed : tsocketevent ; + ondataAvailable : tsocketevent ; + onsessionAvailable : tsocketevent ; + + onsessionconnected : tsocketevent ; + onsenddata : tsenddata ; + ondatasent : tsocketevent ; + //connected : boolean ; + nextasin : tlasio ; + prevasin : tlasio ; + + recvq : tfifo; + OnBgException : TBgExceptionEvent ; + //connectread : boolean ; + sendq : tfifo; + closehandles : boolean ; + writtenthiscycle : boolean ; + onfdwrite : procedure (Sender: TObject; Error: word) of object; //added for bewarehttpd + lasterror:integer; + destroying:boolean; + function receivestr:string; virtual; + procedure close; + procedure abort; + procedure internalclose(error:word); virtual; + constructor Create(AOwner: TComponent); override; + + destructor destroy; override; + procedure fdcleanup; + procedure HandleBackGroundException(E: Exception); + procedure handlefdtrigger(readtrigger,writetrigger:boolean); virtual; + procedure dup(invalue:longint); + + function sendflush : integer; + procedure sendstr(const str : string);virtual; + procedure putstringinsendbuffer(const newstring : string); + function send(data:pointer;len:integer):integer;virtual; + procedure putdatainsendbuffer(data:pointer;len:integer); virtual; + procedure deletebuffereddata; + + //procedure messageloop; + function Receive(Buf:Pointer;BufSize:integer):integer; virtual; + procedure flush;virtual;{$ifdef win32} abstract;{$endif} + procedure dodatasent(wparam,lparam:longint); + procedure doreceiveloop(wparam,lparam:longint); + procedure sinkdata(sender:tobject;error:word); + + procedure release; override; {test -beware} + + function RealSend(Data : Pointer; Len : Integer) : Integer; //added for bewarehttpd + + procedure myfdclose(fd : integer); virtual;{$ifdef win32}abstract;{$endif} + function myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; virtual;{$ifdef win32}abstract;{$endif} + function myfdread(fd: LongInt;var buf;size: LongInt):LongInt; virtual;{$ifdef win32}abstract;{$endif} + protected + procedure dupnowatch(invalue:longint); + end; + ttimerwrapperinterface=class(tlcomponent) + public + function createwrappedtimer : tobject;virtual;abstract; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);virtual;abstract; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);virtual;abstract; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);virtual;abstract; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);virtual;abstract; + end; + + var + timerwrapperinterface : ttimerwrapperinterface; + type + {$ifdef win32} + ttimeval = record + tv_sec : longint; + tv_usec : longint; + end; + {$endif} + tltimer=class(tlcomponent) + protected + + + wrappedtimer : tobject; + + +// finitialevent : boolean ; + fontimer : tnotifyevent ; + fenabled : boolean ; + finterval : integer ; {miliseconds, default 1000} + {$ifndef win32} + procedure resettimes; + {$endif} +// procedure setinitialevent(newvalue : boolean); + procedure setontimer(newvalue:tnotifyevent); + procedure setenabled(newvalue : boolean); + procedure setinterval(newvalue : integer); + public + //making theese public for now, this code should probablly be restructured later though + prevtimer : tltimer ; + nexttimer : tltimer ; + nextts : ttimeval ; + + constructor create(aowner:tcomponent);override; + destructor destroy;override; +// property initialevent : boolean read finitialevent write setinitialevent; + property ontimer : tnotifyevent read fontimer write setontimer; + property enabled : boolean read fenabled write setenabled; + property interval : integer read finterval write setinterval; + + end; + + ttaskevent=procedure(wparam,lparam:longint) of object; + + tltask=class(tobject) + public + handler : ttaskevent; + obj : tobject; + wparam : longint; + lparam : longint; + nexttask : tltask; + constructor create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); + end; + + + + teventcore=class + public + procedure processmessages; virtual;abstract; + procedure messageloop; virtual;abstract; + procedure exitmessageloop; virtual;abstract; + procedure setfdreverse(fd : integer;reverseto : tlasio);virtual;abstract; + procedure rmasterset(fd : integer;islistensocket : boolean); virtual;abstract; + procedure rmasterclr(fd: integer); virtual;abstract; + procedure wmasterset(fd : integer); virtual;abstract; + procedure wmasterclr(fd: integer); virtual;abstract; + end; +var + eventcore : teventcore; + +procedure processmessages; +procedure messageloop; +procedure exitmessageloop; + +var + firstasin : tlasio ; + firsttimer : tltimer ; + firsttask , lasttask , currenttask : tltask ; + + numread : integer ; + mustrefreshfds : boolean ; +{ lcoretestcount:integer;} + + asinreleaseflag:boolean; + + +procedure disconnecttasks(aobj:tobject); +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +type + tonaddtask = procedure(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +var + onaddtask : tonaddtask; + + +procedure sleep(i:integer); +{$ifndef nosignal} + procedure prepsigpipe;{$ifndef ver1_0}inline;{$endif} +{$endif} + + +implementation +{$ifndef nosignal} + uses {sockets,}lloopback,lsignal; +{$endif} +{$ifdef win32} + uses windows,winsock; +{$endif} +{$ifndef win32} + {$include unixstuff.inc} +{$endif} +{$include ltimevalstuff.inc} + + +{!!! added sleep call -beware} +procedure sleep(i:integer); +var + tv:ttimeval; +begin + {$ifdef win32} + windows.sleep(i); + {$else} + tv.tv_sec := i div 1000; + tv.tv_usec := (i mod 1000) * 1000; + select(0,nil,nil,nil,@tv); + {$endif} +end; + +destructor tlcomponent.destroy; +begin + disconnecttasks(self); + inherited destroy; +end; + + + + +procedure tlcomponent.release; +begin + released := true; +end; + +procedure tlasio.release; +begin + asinreleaseflag := true; + inherited release; +end; + +procedure tlasio.doreceiveloop; +begin + if recvq.size = 0 then exit; + if assigned(ondataavailable) then ondataavailable(self,0); + if not (wsonoreceiveloop in componentoptions) then + if recvq.size > 0 then tltask.create(self.doreceiveloop,self,0,0); +end; + +function tlasio.receivestr; +begin + setlength(result,recvq.size); + receive(@result[1],length(result)); +end; + +function tlasio.receive(Buf:Pointer;BufSize:integer):integer; +var + i,a,b:integer; + p:pointer; +begin + i := bufsize; + if recvq.size < i then i := recvq.size; + a := 0; + while (a < i) do begin + b := recvq.get(p,i-a); + move(p^,buf^,b); + inc(taddrint(buf),b); + recvq.del(b); + inc(a,b); + end; + result := i; + if wsonoreceiveloop in componentoptions then begin + if recvq.size = 0 then eventcore.rmasterset(fdhandlein,false); + end; +end; + +constructor tlasio.create; +begin + inherited create(AOwner); + sendq := tfifo.create; + recvq := tfifo.create; + state := wsclosed; + fdhandlein := -1; + fdhandleout := -1; + nextasin := firstasin; + prevasin := nil; + if assigned(nextasin) then nextasin.prevasin := self; + firstasin := self; + + released := false; +end; + +destructor tlasio.destroy; +begin + destroying := true; + if state <> wsclosed then close; + if prevasin <> nil then begin + prevasin.nextasin := nextasin; + end else begin + firstasin := nextasin; + end; + if nextasin <> nil then begin + nextasin.prevasin := prevasin; + end; + recvq.destroy; + sendq.destroy; + inherited destroy; +end; + +procedure tlasio.close; +begin + internalclose(0); +end; + +procedure tlasio.abort; +begin + close; +end; + +procedure tlasio.fdcleanup; +begin + if fdhandlein <> -1 then begin + eventcore.rmasterclr(fdhandlein); //fd_clr(fdhandlein,fdsrmaster) + end; + if fdhandleout <> -1 then begin + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster) + end; + if fdhandlein=fdhandleout then begin + if fdhandlein <> -1 then begin + myfdclose(fdhandlein); + end; + end else begin + if fdhandlein <> -1 then begin + myfdclose(fdhandlein); + end; + if fdhandleout <> -1 then begin + myfdclose(fdhandleout); + end; + end; + fdhandlein := -1; + fdhandleout := -1; +end; + +procedure tlasio.internalclose(error:word); +begin + if state<>wsclosed then begin + if (fdhandlein < 0) or (fdhandleout < 0) then raise exception.create('internalclose called with invalid fd handles'); + eventcore.rmasterclr(fdhandlein);//fd_clr(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); + + if closehandles then begin + {$ifndef win32} + //anyone remember why this is here? --plugwash + fcntl(fdhandlein,F_SETFL,0); + {$endif} + myfdclose(fdhandlein); + if fdhandleout <> fdhandlein then begin + {$ifndef win32} + fcntl(fdhandleout,F_SETFL,0); + {$endif} + myfdclose(fdhandleout); + end; + eventcore.setfdreverse(fdhandlein,nil); + eventcore.setfdreverse(fdhandleout,nil); + + fdhandlein := -1; + fdhandleout := -1; + end; + state := wsclosed; + + if assigned(onsessionclosed) then if not destroying then onsessionclosed(self,error); + end; + sendq.del(maxlongint); +end; + + +{* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *} +{ All exceptions *MUST* be handled. If an exception is not handled, the } +{ application will most likely be shut down ! } +procedure tlasio.HandleBackGroundException(E: Exception); +var + CanAbort : Boolean; +begin + CanAbort := TRUE; + { First call the error event handler, if any } + if Assigned(OnBgException) then begin + try + OnBgException(Self, E, CanAbort); + except + end; + end; + { Then abort the socket } + if CanAbort then begin + try + close; + except + end; + end; +end; + +procedure tlasio.sendstr(const str : string); +begin + putstringinsendbuffer(str); + sendflush; +end; + +procedure tlasio.putstringinsendbuffer(const newstring : string); +begin + if newstring <> '' then putdatainsendbuffer(@newstring[1],length(newstring)); +end; + +function tlasio.send(data:pointer;len:integer):integer; +begin + if state <> wsconnected then begin + result := -1; + exit; + end; + if len < 0 then len := 0; + result := len; + putdatainsendbuffer(data,len); + sendflush; +end; + + +procedure tlasio.putdatainsendbuffer(data:pointer;len:integer); +begin + sendq.add(data,len); +end; + +function tlasio.sendflush : integer; +var + lensent : integer; + data:pointer; +// fdstestr : fdset; +// fdstestw : fdset; +begin + if state <> wsconnected then exit; + + lensent := sendq.get(data,2920); + if assigned(data) then result := myfdwrite(fdhandleout,data^,lensent) else result := 0; + + if result = -1 then lensent := 0 else lensent := result; + + //sendq := copy(sendq,lensent+1,length(sendq)-lensent); + sendq.del(lensent); + + //fd_clr(fdhandleout,fdsw); // this prevents the socket being closed by a write + // that sends nothing because a previous socket has + // slready flushed this socket when the message loop + // reaches it +// if sendq.size > 0 then begin + eventcore.wmasterset(fdhandleout);//fd_set(fdhandleout,fdswmaster); +// end else begin +// wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); +// end; + if result > 0 then begin + if assigned(onsenddata) then onsenddata(self,result); +// if sendq.size=0 then if assigned(ondatasent) then begin +// tltask.create(self.dodatasent,self,0,0); +// //begin test code +// fd_zero(fdstestr); +// fd_zero(fdstestw); +// fd_set(fdhandlein,fdstestr); +// fd_set(fdhandleout,fdstestw); +// select(maxs,@fdstestr,@fdstestw,nil,0); +// writeln(fd_isset(fdhandlein,fdstestr),' ',fd_isset(fdhandleout,fdstestw)); +// //end test code +// +// end; + writtenthiscycle := true; + end; +end; + +procedure tlasio.dupnowatch(invalue:longint); +begin + { debugout('invalue='+inttostr(invalue));} + //readln; + if state<> wsclosed then close; + fdhandlein := invalue; + fdhandleout := invalue; + eventcore.setfdreverse(fdhandlein,self); + {$ifndef win32} + fcntl(fdhandlein,F_SETFL,OPEN_NONBLOCK); + {$endif} + state := wsconnected; + +end; + + +procedure tlasio.dup(invalue:longint); +begin + dupnowatch(invalue); + eventcore.rmasterset(fdhandlein,false);//fd_set(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); +end; + + +procedure tlasio.handlefdtrigger(readtrigger,writetrigger:boolean); +var + sendflushresult : integer; + tempbuf:array[0..receivebufsize-1] of byte; +begin + if (state=wsconnected) and writetrigger then begin + //writeln('write trigger'); + + if (sendq.size >0) then begin + + sendflushresult := sendflush; + if (sendflushresult <= 0) and (not writtenthiscycle) then begin + if sendflushresult=0 then begin // linuxerror := 0; + internalclose(0); + + end else begin + internalclose({$ifdef win32}getlasterror{$else}linuxerror{$endif}); + end; + end; + + end else begin + //everything is sent fire off ondatasent event + if fdhandleout >= 0 then eventcore.wmasterclr(fdhandleout);//fd_clr(fdhandleout,fdswmaster); + if assigned(ondatasent) then tltask.create(self.dodatasent,self,0,0); + end; + if assigned(onfdwrite) then onfdwrite(self,0); + end; + writtenthiscycle := false; + if (state =wsconnected) and readtrigger then begin + if recvq.size=0 then begin + numread := myfdread(fdhandlein,tempbuf,sizeof(tempbuf)); + if (numread=0) and (not mustrefreshfds) then begin + {if i remember correctly numread=0 is caused by eof + if this isn't dealt with then you get a cpu eating infinite loop + however if onsessionconencted has called processmessages that could + cause us to drop to here with an empty recvq and nothing left to read + and we don't want that to cause the socket to close} + + internalclose(0); + end else if (numread=-1) then begin + {$ifdef win32} + //sometimes on windows we get stale messages due to the inherent delays + //in the windows message queue + if WSAGetLastError = wsaewouldblock then begin + //do nothing + end else + {$endif} + begin + numread := 0; + internalclose({$ifdef win32}wsagetlasterror{$else}linuxerror{$endif}); + end; + end else if numread > 0 then recvq.add(@tempbuf,numread); + end; + + if recvq.size > 0 then begin + if wsonoreceiveloop in componentoptions then eventcore.rmasterclr(fdhandlein); //fd_clr(fdhandlein,fdsrmaster); + if assigned(ondataavailable) then ondataAvailable(self,0); + if not (wsonoreceiveloop in componentoptions) then if recvq.size > 0 then + tltask.create(self.doreceiveloop,self,0,0); + end; + //until (numread = 0) or (currentsocket.state<>wsconnected); +{ debugout('inner loop complete');} + end; +end; + +{$ifndef win32} + procedure tlasio.flush; + var + fds : fdset; + begin + fd_zero(fds); + fd_set(fdhandleout,fds); + while sendq.size>0 do begin + select(fdhandleout+1,nil,@fds,nil,nil); + if sendflush <= 0 then exit; + end; + end; +{$endif} + +procedure tlasio.dodatasent(wparam,lparam:longint); +begin + if assigned(ondatasent) then ondatasent(self,lparam); +end; + +procedure tlasio.deletebuffereddata; +begin + sendq.del(maxlongint); +end; + +procedure tlasio.sinkdata(sender:tobject;error:word); +begin + tlasio(sender).recvq.del(maxlongint); +end; + +{$ifndef win32} + procedure tltimer.resettimes; + begin + gettimeofday(nextts); + {if not initialevent then} tv_add(nextts,interval); + end; +{$endif} + +{procedure tltimer.setinitialevent(newvalue : boolean); +begin + if newvalue <> finitialevent then begin + finitialevent := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setinitialevent(wrappedtimer,newvalue); + end else begin + resettimes; + end; + end; +end;} + +procedure tltimer.setontimer(newvalue:tnotifyevent); +begin + if @newvalue <> @fontimer then begin + fontimer := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setontimer(wrappedtimer,newvalue); + end else begin + + end; + end; + +end; + + +procedure tltimer.setenabled(newvalue : boolean); +begin + if newvalue <> fenabled then begin + fenabled := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setenabled(wrappedtimer,newvalue); + end else begin + {$ifdef win32} + raise exception.create('non wrapper timers are not permitted on windows'); + {$else} + resettimes; + {$endif} + end; + end; +end; + +procedure tltimer.setinterval(newvalue:integer); +begin + if newvalue <> finterval then begin + finterval := newvalue; + if assigned(timerwrapperinterface) then begin + timerwrapperinterface.setinterval(wrappedtimer,newvalue); + end else begin + {$ifdef win32} + raise exception.create('non wrapper timers are not permitted on windows'); + {$else} + resettimes; + {$endif} + end; + end; + +end; + + + + +constructor tltimer.create; +begin + inherited create(AOwner); + if assigned(timerwrapperinterface) then begin + wrappedtimer := timerwrapperinterface.createwrappedtimer; + end else begin + + + nexttimer := firsttimer; + prevtimer := nil; + + if assigned(nexttimer) then nexttimer.prevtimer := self; + firsttimer := self; + end; + interval := 1000; + enabled := true; + released := false; + +end; + +destructor tltimer.destroy; +begin + if assigned(timerwrapperinterface) then begin + wrappedtimer.free; + end else begin + if prevtimer <> nil then begin + prevtimer.nexttimer := nexttimer; + end else begin + firsttimer := nexttimer; + end; + if nexttimer <> nil then begin + nexttimer.prevtimer := prevtimer; + end; + + end; + inherited destroy; +end; + +constructor tltask.create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + inherited create; + if assigned(onaddtask) then onaddtask(ahandler,aobj,awparam,alparam); + handler := ahandler; + obj := aobj; + wparam := awparam; + lparam := alparam; + {nexttask := firsttask; + firsttask := self;} + if assigned(lasttask) then begin + lasttask.nexttask := self; + end else begin + firsttask := self; + end; + lasttask := self; + //ahandler(wparam,lparam); +end; + +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + + tltask.create(ahandler,aobj,awparam,alparam); +end; + +{$ifndef nosignal} + procedure prepsigpipe;{$ifndef ver1_0}inline; +{$endif} + begin + starthandlesignal(sigpipe); + if not assigned(signalloopback) then begin + signalloopback := tlloopback.create(nil); + signalloopback.ondataAvailable := signalloopback.sinkdata; + + end; + + end; +{$endif} + +procedure processtasks;//inline; +var + temptask : tltask ; + +begin + + if not assigned(currenttask) then begin + currenttask := firsttask; + firsttask := nil; + lasttask := nil; + end; + while assigned(currenttask) do begin + + if assigned(currenttask.handler) then currenttask.handler(currenttask.wparam,currenttask.lparam); + if assigned(currenttask) then begin + temptask := currenttask; + currenttask := currenttask.nexttask; + temptask.free; + end; + //writeln('processed a task'); + end; + +end; + + + + +procedure disconnecttasks(aobj:tobject); +var + currenttasklocal : tltask ; + counter : byte ; +begin + for counter := 0 to 1 do begin + if counter = 0 then begin + currenttasklocal := firsttask; //main list of tasks + end else begin + currenttasklocal := currenttask; //needed in case called from a task + end; + // note i don't bother to sestroy the links here as that will happen when + // the list of tasks is processed anyway + while assigned(currenttasklocal) do begin + if currenttasklocal.obj = aobj then begin + currenttasklocal.obj := nil; + currenttasklocal.handler := nil; + end; + currenttasklocal := currenttasklocal.nexttask; + end; + end; +end; + + +procedure processmessages; +begin + eventcore.processmessages; +end; +procedure messageloop; +begin + eventcore.messageloop; +end; + +procedure exitmessageloop; +begin + eventcore.exitmessageloop; +end; + +function tlasio.RealSend(Data : Pointer; Len : Integer) : Integer; +begin + result := myfdwrite(fdhandleout,data^,len); + if (result > 0) and assigned(onsenddata) then onsenddata(self,result); + eventcore.wmasterset(fdhandleout); +end; +{$ifndef win32} + procedure tlasio.myfdclose(fd : integer); + begin + fdclose(fd); + end; + function tlasio.myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; + begin + result := fdwrite(fd,buf,size); + end; + + function tlasio.myfdread(fd: LongInt;var buf;size: LongInt):LongInt; + begin + result := fdread(fd,buf,size); + end; + + +{$endif} + + +begin + firstasin := nil; + firsttask := nil; + + + {$ifndef nosignal} + signalloopback := nil; + {$endif} +end. + + + + + diff --git a/lcoregtklaz.pas b/lcoregtklaz.pas new file mode 100755 index 0000000..bbf4418 --- /dev/null +++ b/lcoregtklaz.pas @@ -0,0 +1,142 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit lcoregtklaz; +{$mode delphi} +interface + +uses baseunix,unix,glib, gdk, gtk,lcore,forms,fd_utils,classes; +//procedure lcoregtklazrun; +const + G_IO_IN=1; + G_IO_OUT=4; + G_IO_PRI=2; + G_IO_ERR=8; + + G_IO_HUP=16; + G_IO_NVAL=32; +type + tlaztimerwrapperinterface=class(ttimerwrapperinterface) + public + function createwrappedtimer : tobject;override; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);override; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);override; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);override; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);override; + end; + +procedure lcoregtklazinit; +implementation + uses + ExtCtrls; +{$I unixstuff.inc} +var + giochannels : array[0..absoloutemaxs] of pgiochannel; + +function iocallback(source:PGIOChannel; condition:TGIOCondition; data:gpointer):gboolean;cdecl; +// return true if we want the callback to stay +var + fd : integer ; + fdsrlocal , fdswlocal : fdset ; + currentasio : tlasio ; +begin + fd := g_io_channel_unix_get_fd(source); + fd_zero(fdsrlocal); + fd_set(fd,fdsrlocal); + fdswlocal := fdsrlocal; + select(fd+1,@fdsrlocal,@fdswlocal,nil,0); + if fd_isset(fd,fdsrlocal) or fd_isset(fd,fdsrlocal) then begin + currentasio := fdreverse[fd]; + if assigned(currentasio) then begin + currentasio.handlefdtrigger(fd_isset(currentasio.fdhandlein,fdsrlocal),fd_isset(currentasio.fdhandleout,fdswlocal)); + end else begin + rmasterclr(fd); + wmasterclr(fd); + end; + end; + case condition of + G_IO_IN : begin + result := rmasterisset(fd); + end; + G_IO_OUT : begin + result := wmasterisset(fd); + end; + end; +end; + +procedure gtkrmasterset(fd : integer); +begin + if not assigned(giochannels[fd]) then giochannels[fd] := g_io_channel_unix_new(fd); + g_io_add_watch(giochannels[fd],G_IO_IN,iocallback,nil); +end; + +procedure gtkrmasterclr(fd: integer); +begin +end; + +procedure gtkwmasterset(fd : integer); +begin + if not assigned(giochannels[fd]) then giochannels[fd] := g_io_channel_unix_new(fd); + g_io_add_watch(giochannels[fd],G_IO_OUT,iocallback,nil); +end; + +procedure gtkwmasterclr(fd: integer); +begin +end; + +type + tsc = class + procedure dotasksandsink(sender:tobject;error:word); + end; +var + taskloopback : tlloopback; + sc : tsc; +procedure tsc.dotasksandsink(sender:tobject;error:word); +begin + with tlasio(sender) do begin + sinkdata(sender,error); + processtasks; + end; +end; +procedure gtkaddtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + taskloopback.sendstr(' '); + +end; + +procedure lcoregtklazinit; +begin + onrmasterset := gtkrmasterset; + onrmasterclr := gtkrmasterclr; + onwmasterset := gtkwmasterset; + onwmasterclr := gtkwmasterclr; + onaddtask := gtkaddtask; + taskloopback := tlloopback.create(nil); + taskloopback.ondataavailable := sc.dotasksandsink; + timerwrapperinterface := tlaztimerwrapperinterface.create(nil); +end; + +function tlaztimerwrapperinterface.createwrappedtimer : tobject; +begin + result := ttimer.create(nil); +end; +procedure tlaztimerwrapperinterface.setontimer(wrappedtimer : tobject;newvalue:tnotifyevent); +begin + ttimer(wrappedtimer).ontimer := newvalue; +end; +procedure tlaztimerwrapperinterface.setenabled(wrappedtimer : tobject;newvalue : boolean); +begin + ttimer(wrappedtimer).enabled := newvalue; +end; + + +procedure tlaztimerwrapperinterface.setinterval(wrappedtimer : tobject;newvalue : integer); +begin + ttimer(wrappedtimer).interval := newvalue; +end; + + +end. + diff --git a/lcoreselect.pas b/lcoreselect.pas new file mode 100755 index 0000000..e0351eb --- /dev/null +++ b/lcoreselect.pas @@ -0,0 +1,399 @@ +{lsocket.pas} + +{io and timer code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +{$ifdef fpc} + {$ifndef ver1_0} + {$define useinline} + {$endif} +{$endif} + +unit lcoreselect; + + +interface +uses + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, + {$endif} + fd_utils; +var + maxs : longint ; + exitloopflag : boolean ; {if set by app, exit mainloop} + +function getfdsrmaster : fdset; {$ifdef useinline}inline;{$endif} +function getfdswmaster : fdset; {$ifdef useinline}inline;{$endif} + +implementation +uses + lcore,sysutils, + classes,pgtypes,bfifo, + {$ifndef nosignal} + lsignal; + {$endif} + +{$include unixstuff.inc} +{$include ltimevalstuff.inc} +var + fdreverse:array[0..absoloutemaxs] of tlasio; +type + tselecteventcore=class(teventcore) + public + procedure processmessages; override; + procedure messageloop; override; + procedure exitmessageloop;override; + procedure setfdreverse(fd : integer;reverseto : tlasio); override; + procedure rmasterset(fd : integer;islistensocket : boolean); override; + procedure rmasterclr(fd: integer); override; + procedure wmasterset(fd : integer); override; + procedure wmasterclr(fd: integer); override; + end; + +procedure processtimers;inline; +var + tv ,tvnow : ttimeval ; + currenttimer : tltimer ; + temptimer : tltimer ; + +begin + gettimeofday(tvnow); + currenttimer := firsttimer; + while assigned(currenttimer) do begin + //writeln(currenttimer.enabled); + if tv_compare(tvnow,ttimeval(currenttimer.nextts)) and currenttimer.enabled then begin + //if assigned(currenttimer.ontimer) then begin + // if currenttimer.enabled then if currenttimer.initialevent or currenttimer.initialdone then currenttimer.ontimer(currenttimer); + // currenttimer.initialdone := true; + //end; + if assigned(currenttimer.ontimer) then currenttimer.ontimer(currenttimer); + currenttimer.nextts := timeval(tvnow); + tv_add(ttimeval(currenttimer.nextts),currenttimer.interval); + end; + temptimer := currenttimer; + currenttimer := currenttimer.nexttimer; + if temptimer.released then temptimer.free; + end; +end; + +procedure processasios(var fdsr,fdsw:fdset);//inline; +var + currentsocket : tlasio ; + tempsocket : tlasio ; + socketcount : integer ; // for debugging perposes :) + dw,bt:integer; +begin +{ inc(lcoretestcount);} + + //the message loop will exit if all lasio's and ltimer's and lsignal's are destroyed + //if (not assigned(firstasin)) and (not assigned(firsttimer)) and (not assigned(firstsignal)) then exit; + + + {------- test optimised loop} + socketcount := 0; + for dw := (maxs shr 5) downto 0 do if (fdsr[dw] or fdsw[dw]) <> 0 then begin + for bt := 0 to 31 do if (fdsr[dw] or fdsw[dw]) and (1 shl bt) <> 0 then begin + inc(socketcount); + currentsocket := fdreverse[dw shl 5 or bt]; + {if not assigned(currentsocket) then raise exception.create('currentsocket not assigned'); + if currentsocket.fdhandlein < 0 then raise exception.create('currentsocket.fdhandlein out of range');} + {i've seen the out of range case actually happening, so it can happen. test: just close the fd - beware} + if not assigned(currentsocket) then begin + fdclose(dw shl 5 or bt); + continue + end; + if currentsocket.fdhandlein < 0 then begin + fdclose(dw shl 5 or bt); + continue + end; + try + currentsocket.handlefdtrigger(fd_isset(currentsocket.fdhandlein,fdsr),fd_isset(currentsocket.fdhandleout,fdsw)); + except + on E: exception do begin + currentsocket.HandleBackGroundException(e); + end; + end; + + if mustrefreshfds then begin + if select(maxs+1,@fdsr,@fdsw,nil,0) <= 0 then begin + fd_zero(fdsr); + fd_zero(fdsw); + end; + end; + end; + end; + + if asinreleaseflag then begin + asinreleaseflag := false; + currentsocket := firstasin; + while assigned(currentsocket) do begin + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + if tempsocket.released then begin + tempsocket.free; + end; + end; + end; + { + !!! issues: + - sockets which are released may not be freed because theyre never processed by the loop + made new code for handling this, using asinreleaseflag + + - when/why does the mustrefreshfds select apply, sheck if i did it correctly? + + - what happens if calling handlefdtrigger for a socket which does not have an event + } + {------- original loop} + + (* + currentsocket := firstasin; + socketcount := 0; + while assigned(currentsocket) do begin + if mustrefreshfds then begin + if select(maxs,@fdsr,@fdsw,nil,0) <= 0 then begin + fd_zero(fdsr); + fd_zero(fdsw); + end; + end; + try + if fd_isset(currentsocket.fdhandlein,fdsr) or fd_isset(currentsocket.fdhandleout,fdsw) then begin + currentsocket.handlefdtrigger(fd_isset(currentsocket.fdhandlein,fdsr),fd_isset(currentsocket.fdhandleout,fdsw)); + end; + except + on E: exception do begin + currentsocket.HandleBackGroundException(e); + end; + end; + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + inc(socketcount); + if tempsocket.released then begin + tempsocket.free; + end; + end; *) +{ debugout('socketcount='+inttostr(socketcount));} +end; + +procedure tselecteventcore.processmessages; +var + fdsr , fdsw : fdset ; + selectresult : longint ; +begin + mustrefreshfds := false; + {$ifndef nosignal} + prepsigpipe; + {$endif} + selectresult := select(maxs+1,@fdsr,@fdsw,nil,0); + while (selectresult>0) or assigned(firsttask) or assigned(currenttask) do begin; + + processtasks; + processtimers; + if selectresult > 0 then begin + processasios(fdsr,fdsw); + end; + selectresult := select(maxs+1,@fdsr,@fdsw,nil,0); + + end; + mustrefreshfds := true; +end; + + +var + FDSR , FDSW : fdset; + +var + fdsrmaster , fdswmaster : fdset ; + +function getfdsrmaster : fdset; {$ifdef fpc}inline;{$endif} +begin + result := fdsrmaster; +end; +function getfdswmaster : fdset; {$ifdef fpc}inline;{$endif} +begin + result := fdswmaster; +end; + + +Function doSelect(timeOut:PTimeVal):longint;//inline; +var + localtimeval : ttimeval; + maxslocal : integer; +begin + //unblock signals + //zeromemory(@sset,sizeof(sset)); + //sset[0] := ; + fdsr := getfdsrmaster; + fdsw := getfdswmaster; + + if assigned(firsttask) then begin + localtimeval.tv_sec := 0; + localtimeval.tv_usec := 0; + timeout := @localtimeval; + end; + + maxslocal := maxs; + mustrefreshfds := false; +{ debugout('about to call select');} + {$ifndef nosignal} + sigprocmask(SIG_UNBLOCK,@blockset,nil); + {$endif} + result := select(maxslocal+1,@FDSR,@FDSW,nil,timeout); + if result <= 0 then begin + fd_zero(FDSR); + fd_zero(FDSW); + if result=-1 then begin + if linuxerror = SYS_EINTR then begin + // we received a signal it's not a problem + end else begin + raise esocketexception.create('select returned error '+inttostr(linuxerror)); + end; + end; + end; + {$ifndef nosignal} + sigprocmask(SIG_BLOCK,@blockset,nil); + {$endif} +{ debugout('select complete');} +end; + +procedure tselecteventcore.exitmessageloop; +begin + exitloopflag := true +end; + + + +procedure tselecteventcore.messageloop; +var + tv ,tvnow : ttimeval ; + currenttimer : tltimer ; + selectresult:integer; +begin + {$ifndef nosignal} + prepsigpipe; + {$endif} + {currentsocket := firstasin; + if not assigned(currentsocket) then exit; //the message loop will exit if all lsockets are destroyed + repeat + + if currentsocket.state = wsconnected then currentsocket.sendflush; + currentsocket := currentsocket.nextasin; + until not assigned(currentsocket);} + + + repeat + + //the message loop will exit if all lasio's and ltimer's and lsignal's are destroyed + if (not assigned(firstasin)) and (not assigned(firsttimer)) {$ifndef nosignal} and (not assigned(firstsignal)){$endif} then exit; + {fd_zero(FDSR); + fd_zero(FDSW); + currentsocket := firstasin; + if not assigned(currentsocket) then exit; //the message loop will exit if all lsockets are destroyed + + repeat + if (not currentsocket.released) and (currentsocket.state<>wsclosed) then fd_set(currentsocket.fdhandlein,fdsr); + if (not currentsocket.released) and (currentsocket.state=wsconnecting) then fd_set(currentsocket.fdhandleout,fdsw); + if currentsocket is tlsocket then begin + if (not currentsocket.released) and (currentsocket.state=wsconnected) and(tlsocket(currentsocket).sendq <> '') then fd_set(currentsocket.fdhandleout,fdsw); + end; + tempsocket := currentsocket; + currentsocket := currentsocket.nextasin; + if tempsocket.released then begin + tempsocket.free; + end; + until not assigned(currentsocket); + } + processtasks; + //currenttask := nil; + {beware} + //if assigned(firsttimer) then begin + // tv.tv_sec := maxlongint; + tv := tv_invalidtimebig; + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if tv_compare(tv,currenttimer.nextts) and currenttimer.enabled then tv := currenttimer.nextts; + currenttimer := currenttimer.nexttimer; + end; + + + if tv_compare(tv,tv_invalidtimebig) then begin + //writeln('no timers active'); + if exitloopflag then break; +{ sleep(10);} + selectresult := doselect(nil); + + end else begin + gettimeofday(tvnow); + tv_substract(tv,tvnow); + + //writeln('timers active'); + if tv.tv_sec < 0 then begin + tv.tv_sec := 0; + tv.tv_usec := 0; {0.1 sec} + end; + if exitloopflag then break; +{ sleep(10);} + selectresult := doselect(@tv); + processtimers; + + end; + if selectresult > 0 then processasios(fdsr,fdsw); + {!!!only call processasios if select has asio events -beware} + + {artificial delay to throttle the number of processasios per second possible and reduce cpu usage} + until false; +end; + + +procedure tselecteventcore.rmasterset(fd : integer;islistensocket : boolean); +begin + if fd > absoloutemaxs then raise esocketexception.create('file discriptor out of range'); + if fd > maxs then maxs := fd; + if fd_isset(fd,fdsrmaster) then exit; + fd_set(fd,fdsrmaster); + +end; + +procedure tselecteventcore.rmasterclr(fd: integer); +begin + if not fd_isset(fd,fdsrmaster) then exit; + fd_clr(fd,fdsrmaster); + +end; + + +procedure tselecteventcore.wmasterset(fd : integer); +begin + if fd > absoloutemaxs then raise esocketexception.create('file discriptor out of range'); + if fd > maxs then maxs := fd; + + if fd_isset(fd,fdswmaster) then exit; + fd_set(fd,fdswmaster); + +end; + +procedure tselecteventcore.wmasterclr(fd: integer); +begin + if not fd_isset(fd,fdswmaster) then exit; + fd_clr(fd,fdswmaster); +end; + +procedure tselecteventcore.setfdreverse(fd : integer;reverseto : tlasio); +begin + fdreverse[fd] := reverseto; +end; + + + +begin + eventcore := tselecteventcore.create; + + maxs := 0; + fd_zero(fdsrmaster); + fd_zero(fdswmaster); +end. diff --git a/lcoretest.dof b/lcoretest.dof new file mode 100755 index 0000000..097f5c8 --- /dev/null +++ b/lcoretest.dof @@ -0,0 +1,75 @@ +[Compiler] +A=1 +B=0 +C=1 +D=1 +E=0 +F=0 +G=1 +H=1 +I=1 +J=1 +K=0 +L=1 +M=0 +N=1 +O=1 +P=1 +Q=0 +R=0 +S=0 +T=0 +U=0 +V=1 +W=0 +X=1 +Y=0 +Z=1 +ShowHints=1 +ShowWarnings=1 +UnitAliases=WinTypes=Windows;WinProcs=Windows;DbiTypes=BDE;DbiProcs=BDE;DbiErrs=BDE; +[Linker] +MapFile=0 +OutputObjs=0 +ConsoleApp=0 +DebugInfo=0 +MinStackSize=16384 +MaxStackSize=1048576 +ImageBase=4194304 +ExeDescription= +[Directories] +OutputDir= +UnitOutputDir= +SearchPath= +Packages=vclx30;VCL30;vcldb30;vcldbx30;VclSmp30;Qrpt30;teeui30;teedb30;tee30;IBEVNT30 +Conditionals=ipv6 +DebugSourceDirs= +UsePackages=0 +[Parameters] +RunParams= +HostApplication= +[Version Info] +IncludeVerInfo=0 +AutoIncBuild=0 +MajorVer=1 +MinorVer=0 +Release=0 +Build=0 +Debug=0 +PreRelease=0 +Special=0 +Private=0 +DLL=0 +Locale=2057 +CodePage=1252 +[Version Info Keys] +CompanyName= +FileDescription= +FileVersion=1.0.0.0 +InternalName= +LegalCopyright= +LegalTrademarks= +OriginalFilename= +ProductName= +ProductVersion=1.0.0.0 +Comments= diff --git a/lcoretest.dpr b/lcoretest.dpr new file mode 100755 index 0000000..f6fe72b --- /dev/null +++ b/lcoretest.dpr @@ -0,0 +1,181 @@ +program lcoretest; + +uses + lcore, + lsocket, + {$ifdef win32} + lcorewsaasyncselect in 'lcorewsaasyncselect.pas', + {$else} + lcoreselect, + {$endif} + dnsasync, + binipstuff, + sysutils, + dnssync; +{$ifdef win32} + {$R *.RES} +{$endif} + +type + tsc=class + procedure sessionavailable(sender: tobject;error : word); + procedure dataavailable(sender: tobject;error : word); + procedure sessionconnected(sender: tobject;error : word); + procedure taskrun(wparam,lparam:longint); + procedure timehandler(sender:tobject); + procedure dnsrequestdone(sender:tobject;error : word); + procedure sessionclosed(sender:tobject;error : word); + end; +var + listensocket : tlsocket; + serversocket : tlsocket; + clientsocket : tlsocket; + sc : tsc; + task : tltask; +procedure tsc.sessionavailable(sender: tobject;error : word); +begin + writeln('received connection'); + serversocket.dup(listensocket.accept); +end; + +var + receivebuf : string; + receivecount : integer; +procedure tsc.dataavailable(sender: tobject;error : word); +var + receiveddata : string; + receivedon : string; + line : string; +begin + receiveddata := tlsocket(sender).receivestr; + if sender=clientsocket then begin + receivedon := 'client socket'; + end else begin + receivedon := 'server socket'; + end; + writeln('received data '+receiveddata+' on '+receivedon); + + receivebuf := receivebuf+receiveddata; + + if receivebuf = 'hello world' then begin + receivebuf := ''; + writeln('received hello world creating task'); + task := tltask.create(sc.taskrun,nil,0,0); + end; + receivecount := receivecount +1; + if receivecount >50 then begin + writeln('received over 50 bits of data, pausing to let the operator take a look'); + readln; + receivecount := 0; + end; + while pos(#10,receivebuf) > 0 do begin + line := receivebuf; + setlength(line,pos(#10,receivebuf)-1); + receivebuf := copy(receivebuf,pos(#10,receivebuf)+1,1000000); + if uppercase(copy(line,1,4))='PING' then begin + line[2] := 'o'; + writeln('send pong:'+line); + clientsocket.sendstr(line+#10); + end; + end; +end; + +procedure tsc.sessionconnected(sender: tobject;error : word); +begin + if error=0 then begin + writeln('session is connected, local address is'+clientsocket.getxaddr); + + if (clientsocket.addr = '127.0.0.1') or (clientsocket.addr = '::1') then begin + clientsocket.sendstr('hello world'); + end else begin + clientsocket.sendstr('nick test'#13#10'user x x x x'#13#10); + end; + end else begin + writeln('connect failed'); + end; +end; + +var + das : tdnsasync; + +procedure tsc.taskrun(wparam,lparam:longint); +var + tempbinip : tbinip; + dummy : integer; +begin + writeln('task ran'); + writeln('closing client socket'); + clientsocket.close; + + writeln('looking up irc.ipv6.p10link.net using dnsasync'); + das := tdnsasync.Create(nil); + das.onrequestdone := sc.dnsrequestdone; + //das.forwardfamily := af_inet6; + das.forwardlookup('irc.ipv6.p10link.net'); +end; + +procedure tsc.dnsrequestdone(sender:tobject;error : word); +begin + writeln('irc.ipv6.p10link.net resolved to '+das.dnsresult+' connecting client socket there'); + clientsocket.addr := das.dnsresult; + clientsocket.port := '6667'; + clientsocket.connect; + writeln(clientsocket.getxaddr); + das.free; +end; + +procedure tsc.timehandler(sender:tobject); +begin + //writeln('got timer event'); +end; +procedure tsc.sessionclosed(sender:tobject;error : word); +begin + Writeln('session closed with error ',error); +end; +var + timer : tltimer; + ipbin : tbinip; + dummy : integer; +begin + ipbin := forwardlookup('invalid.domain',5); + writeln(ipbintostr(ipbin)); + + ipbin := forwardlookup('p10link.net',5); + writeln(ipbintostr(ipbin)); + + ipstrtobin('80.68.89.68',ipbin); + writeln('80.68.89.68 reverses to '+reverselookup(ipbin,5)); + + ipstrtobin('2001:200::8002:203:47ff:fea5:3085',ipbin); + writeln('2001:200::8002:203:47ff:fea5:3085 reverses to '+reverselookup(ipbin,5)); + writeln('creating and setting up listen socket'); + listensocket := tlsocket.create(nil); + listensocket.addr := '::'; + listensocket.port := '12345'; + listensocket.onsessionavailable := sc.sessionavailable; + writeln('listening'); + listensocket.listen; + writeln(listensocket.getxport); + writeln('listen socket is number ', listensocket.fdhandlein); + writeln('creating and setting up server socket'); + serversocket := tlsocket.create(nil); + serversocket.ondataavailable := sc.dataavailable; + writeln('creating and setting up client socket'); + clientsocket := tlsocket.create(nil); + clientsocket.addr := '::1';{'127.0.0.1';} + clientsocket.port := '12345'; + clientsocket.onsessionconnected := sc.sessionconnected; + clientsocket.ondataAvailable := sc.dataavailable; + clientsocket.onsessionclosed := sc.sessionclosed; + writeln('connecting'); + clientsocket.connect; + writeln('client socket is number ',clientsocket.fdhandlein); + writeln('creating and setting up timer'); + timer := tltimer.create(nil); + timer.interval := 1000; + timer.ontimer := sc.timehandler; + timer.enabled := true; + writeln('entering message loop'); + messageloop; + writeln('exiting cleanly'); +end. diff --git a/lcoretest.res b/lcoretest.res new file mode 100755 index 0000000..a528693 Binary files /dev/null and b/lcoretest.res differ diff --git a/lcorewsaasyncselect.pas b/lcorewsaasyncselect.pas new file mode 100755 index 0000000..a978c23 --- /dev/null +++ b/lcorewsaasyncselect.pas @@ -0,0 +1,216 @@ +unit lcorewsaasyncselect; + +interface + +implementation +uses wcore,lcore,bsearchtree,sysutils,windows,winsock,pgtypes,messages,classes; +type + twineventcore=class(teventcore) + public + procedure processmessages; override; + procedure messageloop; override; + procedure exitmessageloop;override; + procedure setfdreverse(fd : integer;reverseto : tlasio); override; + procedure rmasterset(fd : integer;islistensocket : boolean); override; + procedure rmasterclr(fd: integer); override; + procedure wmasterset(fd : integer); override; + procedure wmasterclr(fd: integer); override; + end; +const + wm_dotasks=wm_user+1; +type + twintimerwrapperinterface=class(ttimerwrapperinterface) + public + function createwrappedtimer : tobject;override; +// procedure setinitialevent(wrappedtimer : tobject;newvalue : boolean);override; + procedure setontimer(wrappedtimer : tobject;newvalue:tnotifyevent);override; + procedure setenabled(wrappedtimer : tobject;newvalue : boolean);override; + procedure setinterval(wrappedtimer : tobject;newvalue : integer);override; + end; + +procedure twineventcore.processmessages; +begin + wcore.processmessages;//pass off to wcore +end; +procedure twineventcore.messageloop; +begin + wcore.messageloop; //pass off to wcore +end; +procedure twineventcore.exitmessageloop; +begin + wcore.exitmessageloop; +end; +var + fdreverse : thashtable; + fdwatches : thashtable; + +procedure twineventcore.setfdreverse(fd : integer;reverseto : tlasio); +begin + if findtree(@fdreverse,inttostr(fd)) <> nil then deltree(@fdreverse,inttostr(fd)); + if reverseto <> nil then addtree(@fdreverse,inttostr(fd),reverseto); +end; + +var + hwndlcore : hwnd; +procedure dowsaasyncselect(fd:integer; leventadd: integer; leventremove : integer); +var + leventold : integer; + leventnew : integer; + wsaaresult : integer; +begin + leventold := taddrint(findtree(@fdwatches,inttostr(fd))); + leventnew := leventold or leventadd; + leventnew := leventnew and not leventremove; + if leventold <> leventnew then begin + if leventold <> 0 then deltree(@fdwatches,inttostr(fd)); + if leventnew <> 0 then addtree(@fdwatches,inttostr(fd),pointer(leventnew)); + end; + wsaaresult := wsaasyncselect(fd,hwndlcore,wm_user,leventnew); + +end; + + +//to allow detection of errors: +//if we are asked to monitor for read or accept we also monitor for close +//if we are asked to monitor for write we also monitor for connect + + +procedure twineventcore.rmasterset(fd : integer;islistensocket : boolean); +begin + if islistensocket then begin + //writeln('setting accept watch for socket number ',fd); + dowsaasyncselect(fd,FD_ACCEPT or FD_CLOSE,0); + end else begin + //writeln('setting read watch for socket number',fd); + dowsaasyncselect(fd,FD_READ or FD_CLOSE,0); + end; +end; +procedure twineventcore.rmasterclr(fd: integer); +begin + //writeln('clearing read of accept watch for socket number ',fd); + dowsaasyncselect(fd,0,FD_ACCEPT or FD_READ or FD_CLOSE); +end; +procedure twineventcore.wmasterset(fd : integer); +begin + dowsaasyncselect(fd,FD_WRITE or FD_CONNECT,0); +end; + +procedure twineventcore.wmasterclr(fd: integer); +begin + dowsaasyncselect(fd,0,FD_WRITE or FD_CONNECT); +end; + +var + tasksoutstanding : boolean; + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + socket : integer; + event : integer; + error : integer; + readtrigger : boolean; + writetrigger : boolean; + lasio : tlasio; +begin + //writeln('got a message'); + Result := 0; // This means we handled the message + if (ahwnd=hwndlcore) and (aumsg=wm_user) then begin + //writeln('it appears to be a response to our wsaasyncselect'); + socket := awparam; + event := alparam and $FFFF; + error := alparam shr 16; + //writeln('socket=',socket,' event=',event,' error=',error); + readtrigger := false; + writetrigger := false; + lasio := findtree(@fdreverse,inttostr(socket)); + if assigned(lasio) then begin + if (error <> 0) or ((event and FD_CLOSE) <> 0) then begin + if lasio.state = wsconnecting then begin + lasio.onsessionconnected(lasio,error); + end; + lasio.internalclose(error); + end else begin + if (event and (FD_READ or FD_ACCEPT)) <> 0 then readtrigger := true; + if (event and (FD_WRITE)) <> 0 then writetrigger := true; + + if readtrigger or writetrigger then lasio.handlefdtrigger(readtrigger,writetrigger); + end; + dowsaasyncselect(socket,0,0); //reset watches + end; + end else if (ahwnd=hwndlcore) and (aumsg=wm_dotasks) then begin + //writeln('processing tasks'); + tasksoutstanding := false; + processtasks; + end else begin + //writeln('passing unknown message to defwindowproc'); + //not passing unknown messages on to defwindowproc will cause window + //creation to fail! --plugwash + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; + +end; + +procedure winaddtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + if not tasksoutstanding then PostMessage(hwndlcore,wm_dotasks,0,0); +end; +type + twcoretimer = wcore.tltimer; + +function twintimerwrapperinterface.createwrappedtimer : tobject; +begin + result := twcoretimer.create(nil); +end; +procedure twintimerwrapperinterface.setontimer(wrappedtimer : tobject;newvalue:tnotifyevent); +begin + twcoretimer(wrappedtimer).ontimer := newvalue; +end; +procedure twintimerwrapperinterface.setenabled(wrappedtimer : tobject;newvalue : boolean); +begin + twcoretimer(wrappedtimer).enabled := newvalue; +end; + + +procedure twintimerwrapperinterface.setinterval(wrappedtimer : tobject;newvalue : integer); +begin + twcoretimer(wrappedtimer).interval := newvalue; +end; + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'lcoreClass'); + GInitData: TWSAData; + +begin + eventcore := twineventcore.create; + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create lcore handle, hinstance=',hinstance); + hwndlcore := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + //writeln('lcore hwnd is ',hwndlcore); + //writeln('last error is ',GetLastError); + onaddtask := winaddtask; + timerwrapperinterface := twintimerwrapperinterface.create(nil); + + WSAStartup($200, GInitData); +end. diff --git a/lloopback.pas b/lloopback.pas new file mode 100755 index 0000000..7e26d7c --- /dev/null +++ b/lloopback.pas @@ -0,0 +1,34 @@ +unit lloopback; + +interface +uses lcore,classes; + +type + tlloopback=class(tlasio) + public + constructor create(aowner:tcomponent); override; + end; + + +implementation +uses +{$ifdef ver1_0} + linux; +{$else} + baseunix,unix,unixutil; +{$endif} +{$i unixstuff.inc} + +constructor tlloopback.create(aowner:tcomponent); +begin + inherited create(aowner); + closehandles := true; + assignpipe(fdhandlein,fdhandleout); + + eventcore.rmasterset(fdhandlein,false);//fd_set(fdhandlein,fdsrmaster); + eventcore.wmasterclr(fdhandlein);//fd_clr(fdhandleout,fdswmaster); + eventcore.setfdreverse(fdhandlein,self); + eventcore.setfdreverse(fdhandleout,self); + state := wsconnected; +end; +end. diff --git a/lmessages.pas b/lmessages.pas new file mode 100755 index 0000000..7bb73fd --- /dev/null +++ b/lmessages.pas @@ -0,0 +1,656 @@ +unit lmessages; +//windows messages like system based on lcore tasks +interface + +uses pgtypes,sysutils,bsearchtree,strings,syncobjs; + +type + lparam=taddrint; + wparam=taddrint; + thinstance=pointer; + hicon=pointer; + hcursor=pointer; + hbrush=pointer; + hwnd=qword; //window handles are monotonically increasing 64 bit integers, + //this should allow for a million windows per second for over half + //a million years! + + twndproc=function(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; + + + twndclass=record + style : dword; + lpfnwndproc : twndproc; + cbclsextra : integer; + cbwndextra : integer; + hinstance : thinstance; + hicon : hicon; + hcursor : hcursor; + hbrbackground : hbrush; + lpszmenuname : pchar; + lpszclassname : pchar; + end; + PWNDCLASS=^twndclass; + + UINT=dword; + WINBOOL = longbool; + tTIMERPROC = procedure (ahwnd:HWND; umsg:integer; idevent:taddrint;dwtime:taddrint);stdcall; + ATOM = pointer; + LPCSTR = pchar; + LPVOID = pointer; + HMENU = pointer; + HINST = pointer; + + TPOINT = record + x : LONGint; + y : LONGint; + end; + + TMSG = record + hwnd : HWND; + message : UINT; + wParam : WPARAM; + lParam : LPARAM; + time : DWORD; + pt : TPOINT; + end; + THevent=TEventObject; +const + WS_EX_TOOLWINDOW = $80; + WS_POPUP = longint($80000000); + hinstance=nil; + PM_REMOVE = 1; + WM_USER = 1024; + WM_TIMER = 275; + INFINITE = syncobjs.infinite; +function getwindowlongptr(ahwnd:hwnd;nindex:integer) : taddrint; +function setwindowlongptr(ahwnd:hwnd;nindex:integer;dwNewLong : taddrint) : taddrint; +function DefWindowProc(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; +function RegisterClass(const lpWndClass:TWNDCLASS):ATOM; +function CreateWindowEx(dwExStyle:DWORD; lpClassName:LPCSTR; lpWindowName:LPCSTR; dwStyle:DWORD; X:longint;Y:longint; nWidth:longint; nHeight:longint; hWndParent:HWND; hMenu:HMENU;hInstance:HINST; lpParam:LPVOID):HWND; +function DestroyWindow(ahWnd:HWND):WINBOOL; +function PostMessage(hWnd:HWND; Msg:UINT; wParam:WPARAM; lParam:LPARAM):WINBOOL; +function PeekMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax, wRemoveMsg: UINT): WINBOOL; +function DispatchMessage(const lpMsg: TMsg): Longint; +function GetMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT): WINBOOL; +function SetEvent(hEvent:THevent):WINBOOL; +function CreateEvent(lpEventAttributes:PSECURITYATTRIBUTES; bManualReset:WINBOOL; bInitialState:WINBOOL; lpName:pchar):tHevent; +function terminatethread(threadhandle : tthreadid;dummy:integer) : boolean; +function waitforsingleevent(event:thevent;timeout:cardinal) : twaitresult; +function SetTimer(ahWnd:HWND; nIDEvent:taddrint; uElapse:UINT; lpTimerFunc:tTIMERPROC):UINT; +function KillTimer(ahWnd:HWND; uIDEvent:taddrint):WINBOOL; + +procedure init; + +implementation +uses + baseunix,unix,lcore;//,safewriteln; +{$i unixstuff.inc} + +type + tmessageintransit = class + msg : tmsg; + next : tmessageintransit; + end; + + tthreaddata = class + messagequeue : tmessageintransit; + messageevent : teventobject; + waiting : boolean; + lcorethread : boolean; + nexttimer : ttimeval; + threadid : integer; + end; + twindow=class + hwnd : hwnd; + extrawindowmemory : pointer; + threadid : tthreadid; + windowproc : twndproc; + end; + +var + structurelock : tcriticalsection; + threaddata : thashtable; + windowclasses : thashtable; + lcorelinkpipesend : integer; + lcorelinkpiperecv : tlasio; + windows : thashtable; + //I would rather things crash immediately + //if they use an insufficiant size type + //than crash after over four billion + //windows have been made ;) + nextwindowhandle : qword = $100000000; +{$i ltimevalstuff.inc} + +//findthreaddata should only be called while holding the structurelock +function findthreaddata(threadid : integer) : tthreaddata; +begin + result := tthreaddata(findtree(@threaddata,inttostr(threadid))); + if result = nil then begin + result := tthreaddata.create; + result.messageevent := teventobject.create(nil,false,false,inttostr(taddrint(result))); + result.nexttimer := tv_invalidtimebig; + result.threadid := threadid; + addtree(@threaddata,inttostr(threadid),result); + end; +end; + +//deletethreaddataifunused should only be called while holding the structurelock +procedure deletethreaddataifunused(athreaddata : tthreaddata); +begin + //writeln('in deletethreaddataifunused'); + if (athreaddata <> nil) then if (athreaddata.waiting=false) and (athreaddata.messagequeue=nil) and (athreaddata.lcorethread=false) and (athreaddata.nexttimer.tv_sec=tv_invalidtimebig.tv_sec) and (athreaddata.nexttimer.tv_usec=tv_invalidtimebig.tv_usec) then begin + //writeln('threaddata is unused, freeing messageevent'); + athreaddata.messageevent.free; + //writeln('freeing thread data object'); + athreaddata.free; + //writeln('deleting thread data object from hashtable'); + deltree(@threaddata,inttostr(athreaddata.threadid)); + //writeln('finished deleting thread data'); + end else begin + //writeln('thread data is not unused'); + end; +end; + +function getwindowlongptr(ahwnd:hwnd;nindex:integer) : taddrint; +var + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window <> nil then begin + result := paddrint(taddrint(window.extrawindowmemory)+nindex)^; + end else begin + result := 0; + end; + finally + structurelock.release; + end; +end; + +function setwindowlongptr(ahwnd:hwnd;nindex:integer;dwNewLong : taddrint) : taddrint; +var + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window <> nil then begin + result := paddrint(taddrint(window.extrawindowmemory)+nindex)^; + paddrint(taddrint(window.extrawindowmemory)+nindex)^ := dwnewlong; + end else begin + result := 0; + end; + finally + structurelock.release; + end; + +end; + + +function DefWindowProc(ahWnd:HWND; auMsg:Integer; awParam:WPARAM; alParam:LPARAM):Integer; stdcall; +begin + result := 0; +end; + +function strdup(s:pchar) : pchar; +begin + //swriteln('in strdup, about to allocate memory'); + result := getmem(strlen(s)+1); + //swriteln('about to copy string'); + strcopy(s,result); + //swriteln('leaving strdup'); +end; + +function RegisterClass(const lpWndClass:TWNDCLASS):ATOM; +var + storedwindowclass:pwndclass; +begin + structurelock.acquire; + try + //swriteln('in registerclass, about to check for duplicate window class'); + storedwindowclass := findtree(@windowclasses, lpwndclass.lpszclassname); + if storedwindowclass <> nil then begin + + if comparebyte(storedwindowclass^,lpwndclass,sizeof(twndclass)-sizeof(pchar)-sizeof(pchar)) <> 0 then begin + //swriteln('duplicate window class registered with different settings'); + raise exception.create('duplicate window class registered with different settings'); + end else begin + //swriteln('duplicate window class registered with same settings, tollerated'); + end; + end else begin + //swriteln('about to allocate memory for new windowclass'); + storedwindowclass := getmem(sizeof(twndclass)); + //swriteln('about to copy windowclass from parameter'); + move(lpwndclass,storedwindowclass^,sizeof(twndclass)); + //swriteln('about to copy strings'); + if lpwndclass.lpszmenuname <> nil then storedwindowclass.lpszmenuname := strdup(lpwndclass.lpszmenuname); + if lpwndclass.lpszclassname <> nil then storedwindowclass.lpszclassname := strdup(lpwndclass.lpszclassname); + //swriteln('about to add result to list of windowclasses'); + addtree(@windowclasses,lpwndclass.lpszclassname,storedwindowclass); + end; + //swriteln('about to return result'); + result := storedwindowclass; + //swriteln('leaving registerclass'); + finally + structurelock.release; + end; +end; + +function CreateWindowEx(dwExStyle:DWORD; lpClassName:LPCSTR; lpWindowName:LPCSTR; dwStyle:DWORD; X:longint;Y:longint; nWidth:longint; nHeight:longint; hWndParent:HWND; hMenu:HMENU;hInstance:HINST; lpParam:LPVOID):HWND; +var + wndclass : pwndclass; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := twindow.create; + window.hwnd := nextwindowhandle; + result := window.hwnd; + nextwindowhandle := nextwindowhandle + 1; + addtree(@windows,inttostr(window.hwnd),window); + wndclass := findtree(@windowclasses,lpclassname); + window.extrawindowmemory := getmem(wndclass.cbwndextra); + + getthreadmanager(tm); + window.threadid := tm.GetCurrentThreadId; + window.windowproc := wndclass.lpfnwndproc; + finally + structurelock.release; + end; +end; +function DestroyWindow(ahWnd:HWND):WINBOOL; +var + window : twindow; + windowthreaddata : tthreaddata; + currentmessage : tmessageintransit; + prevmessage : tmessageintransit; +begin + //writeln('started to destroy window'); + structurelock.acquire; + try + window := twindow(findtree(@windows,inttostr(ahwnd))); + if window <> nil then begin + freemem(window.extrawindowmemory); + //writeln('aboute to delete window from windows structure'); + deltree(@windows,inttostr(ahwnd)); + //writeln('deleted window from windows structure'); + windowthreaddata := tthreaddata(findtree(@threaddata,inttostr(window.threadid))); + + if windowthreaddata <> nil then begin + //writeln('found thread data scanning for messages to clean up'); + currentmessage := windowthreaddata.messagequeue; + prevmessage := nil; + while currentmessage <> nil do begin + while (currentmessage <> nil) and (currentmessage.msg.hwnd = ahwnd) do begin + if prevmessage = nil then begin + windowthreaddata.messagequeue := currentmessage.next; + end else begin + prevmessage.next := currentmessage.next; + end; + currentmessage.free; + if prevmessage = nil then begin + currentmessage := windowthreaddata.messagequeue; + end else begin + currentmessage := prevmessage.next; + end; + end; + if currentmessage <> nil then begin + prevmessage := currentmessage; + currentmessage := currentmessage.next; + end; + end; + //writeln('deleting thread data structure if it is unused'); + deletethreaddataifunused(windowthreaddata); + end else begin + //writeln('there is no thread data to search for messages to cleanup'); + end; + //writeln('freeing window'); + window.free; + result := true; + end else begin + result := false; + end; + finally + structurelock.release; + end; + //writeln('window destroyed'); +end; + + + +function PostMessage(hWnd:HWND; Msg:UINT; wParam:WPARAM; lParam:LPARAM):WINBOOL; +var + threaddata : tthreaddata; + message : tmessageintransit; + messagequeueend : tmessageintransit; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(hwnd)); + if window <> nil then begin + threaddata := findthreaddata(window.threadid); + message := tmessageintransit.create; + message.msg.hwnd := hwnd; + message.msg.message := msg; + message.msg.wparam := wparam; + message.msg.lparam := lparam; + if threaddata.lcorethread then begin + //swriteln('posting message to lcore thread'); + fdwrite(lcorelinkpipesend,message,sizeof(message)); + end else begin + //writeln('posting message to non lcore thread'); + if threaddata.messagequeue = nil then begin + threaddata.messagequeue := message; + end else begin + messagequeueend := threaddata.messagequeue; + while messagequeueend.next <> nil do begin + messagequeueend := messagequeueend.next; + end; + messagequeueend.next := message; + end; + + //writeln('message added to queue'); + if threaddata.waiting then threaddata.messageevent.setevent; + end; + result := true; + end else begin + result := false; + end; + finally + structurelock.release; + end; + +end; + +function gettickcount : dword; +var + result64: integer; + tv : ttimeval; +begin + gettimeofday(tv); + result64 := (tv.tv_sec*1000)+(tv.tv_usec div 1000); + result := result64; +end; + +function DispatchMessage(const lpMsg: TMsg): Longint; +var + timerproc : ttimerproc; + window : twindow; + windowproc : twndproc; +begin + ////swriteln('in dispatchmessage, msg.hwnd='+inttohex(taddrint(lpmsg.hwnd),16)); + if (lpmsg.lparam <> 0) and (lpmsg.message = WM_TIMER) then begin + timerproc := ttimerproc(lpmsg.lparam); + timerproc(lpmsg.hwnd,lpmsg.message,lpmsg.wparam,gettickcount); + result := 0; + end else begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(lpmsg.hwnd)); + //we have to get the window procedure while the structurelock + //is still held as the window could be destroyed from another thread + //otherwise. + windowproc := window.windowproc; + finally + structurelock.release; + end; + if window <> nil then begin + result := windowproc(lpmsg.hwnd,lpmsg.message,lpmsg.wparam,lpmsg.lparam); + end else begin + result := -1; + end; + end; +end; + +procedure processtimers; +begin +end; + +function GetMessageinternal(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT; wremovemsg : UINT;peek:boolean): WINBOOL; +var + tm : tthreadmanager; + threaddata : tthreaddata; + message : tmessageintransit; + nowtv : ttimeval; + timeouttv : ttimeval; + timeoutms : int64; + +begin + if hwnd <> 0 then raise exception.create('getting messages for an individual window is not supported'); + if (wmsgfiltermin <> 0) or (wmsgfiltermax <> 0) then raise exception.create('message filtering is not supported'); + structurelock.acquire; + result := true; + try + getthreadmanager(tm); + threaddata := findthreaddata(tm.GetCurrentThreadId); + if threaddata.lcorethread then raise exception.create('get/peek message cannot be used in the lcore thread'); + message := threaddata.messagequeue; + gettimeofday(nowtv); + while (not peek) and (message=nil) and (not tv_compare(nowtv,threaddata.nexttimer)) do begin + threaddata.waiting := true; + structurelock.release; + if (threaddata.nexttimer.tv_sec = TV_invalidtimebig.tv_sec) and (threaddata.nexttimer.tv_usec = TV_invalidtimebig.tv_usec) then begin + threaddata.messageevent.waitfor(INFINITE); + end else begin + + timeouttv := threaddata.nexttimer; + timeoutms := (timeouttv.tv_sec * 1000)+(timeouttv.tv_usec div 1000); + //i'm assuming the timeout is in milliseconds + if (timeoutms > maxlongint) then timeoutms := maxlongint; + threaddata.messageevent.waitfor(timeoutms); + + end; + structurelock.acquire; + threaddata.waiting := false; + message := threaddata.messagequeue; + gettimeofday(nowtv); + end; + if (message=nil) and tv_compare(nowtv,threaddata.nexttimer) then begin + processtimers; + end; + message := threaddata.messagequeue; + if message <> nil then begin + lpmsg := message.msg; + if wremovemsg=PM_REMOVE then begin + threaddata.messagequeue := message.next; + message.free; + end; + end else begin + result :=false; + end; + deletethreaddataifunused(threaddata); + finally + structurelock.release; + end; +end; + +function GetMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax: UINT): WINBOOL; +begin + result := getmessageinternal(lpmsg,hwnd,wmsgfiltermin,wmsgfiltermax,PM_REMOVE,false); +end; + +function PeekMessage(var lpMsg: TMsg; hWnd: HWND; wMsgFilterMin, wMsgFilterMax, wRemoveMsg: UINT): WINBOOL; +begin + result := getmessageinternal(lpmsg,hwnd,wmsgfiltermin,wmsgfiltermax,PM_REMOVE,true); +end; + +function SetEvent(hEvent:THevent):WINBOOL; +begin + hevent.setevent; + result := true; +end; + +function CreateEvent(lpEventAttributes:PSECURITYATTRIBUTES; bManualReset:WINBOOL; bInitialState:WINBOOL; lpName:pchar):tHevent; +begin + result := teventobject.create(lpeventattributes,bmanualreset,binitialstate,lpname); +end; + +function terminatethread(threadhandle:tthreadid;dummy : integer) : boolean; +var + tm : tthreadmanager; +begin + getthreadmanager(tm); + tm.killthread(threadhandle); + result := true; +end; + +function waitforsingleevent(event:thevent;timeout:cardinal) : twaitresult; +begin + result := event.waitfor(timeout); +end; + +procedure removefrombuffer(n : integer; var buffer:string); +begin + if n=length(buffer) then begin + buffer := ''; + end else begin + uniquestring(buffer); + move(buffer[n+1],buffer[1],length(buffer)-n); + setlength(buffer,length(buffer)-n); + end; +end; + +type + tsc=class + procedure available(sender:tobject;error:word); + end; + +var + recvbuf : string; + +procedure tsc.available(sender:tobject;error:word); +var + message : tmessageintransit; + messagebytes : array[1..sizeof(tmessageintransit)] of char absolute message; + i : integer; +begin + //swriteln('received data on lcorelinkpipe'); + recvbuf := recvbuf + lcorelinkpiperecv.receivestr; + while length(recvbuf) >= sizeof(tmessageintransit) do begin + for i := 1 to sizeof(tmessageintransit) do begin + messagebytes[i] := recvbuf[i]; + end; + dispatchmessage(message.msg); + message.free; + removefrombuffer(sizeof(tmessageintransit),recvbuf); + end; +end; + +procedure init; +var + tm : tthreadmanager; + threaddata : tthreaddata; + pipeends : tfildes; + sc : tsc; +begin + structurelock := tcriticalsection.create; + getthreadmanager(tm); + threaddata := findthreaddata(tm.GetCurrentThreadId); + threaddata.lcorethread := true; + fppipe(pipeends); + lcorelinkpipesend := pipeends[1]; + lcorelinkpiperecv := tlasio.create(nil); + lcorelinkpiperecv.dup(pipeends[0]); + lcorelinkpiperecv.ondataavailable := sc.available; + recvbuf := ''; +end; + +var + lcorethreadtimers : thashtable; +type + tltimerformsg = class(tltimer) + public + hwnd : hwnd; + id : taddrint; + procedure timer(sender : tobject); + end; + +procedure tltimerformsg.timer(sender : tobject); +var + msg : tmsg; +begin + ////swriteln('in tltimerformsg.timer'); + fillchar(msg,sizeof(msg),0); + msg.message := WM_TIMER; + msg.hwnd := hwnd; + msg.wparam := ID; + msg.lparam := 0; + dispatchmessage(msg); +end; + +function SetTimer(ahWnd:HWND; nIDEvent:taddrint; uElapse:UINT; lpTimerFunc:tTIMERPROC):UINT; +var + threaddata : tthreaddata; + ltimer : tltimerformsg; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window= nil then raise exception.create('invalid window'); + threaddata := findthreaddata(window.threadid); + finally + structurelock.release; + end; + if threaddata.lcorethread then begin + getthreadmanager(tm); + if tm.GetCurrentThreadId <> window.threadid then raise exception.create('timers on the lcore thread may only be added and removed from the lcore thread'); + if ahwnd = 0 then raise exception.create('timers on the lcore thread must be associated with a window handle'); + if @lptimerfunc <> nil then raise exception.create('seperate timer functions are not supported'); + + //remove preexisting timer with same ID + killtimer(ahwnd,nIDEvent); + + ltimer := tltimerformsg.create(nil); + ltimer.interval := uelapse; + ltimer.id := nidevent; + ltimer.hwnd := ahwnd; + ltimer.enabled := true; + ltimer.ontimer := ltimer.timer; + + addtree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(nIDEvent),ltimer); + + result := nidevent; + end else begin + raise exception.create('settimer not implemented for threads other than the lcore thread'); + end; +end; + +function KillTimer(ahWnd:HWND; uIDEvent:taddrint):WINBOOL; +var + threaddata : tthreaddata; + ltimer : tltimerformsg; + tm : tthreadmanager; + window : twindow; +begin + structurelock.acquire; + try + window := findtree(@windows,inttostr(ahwnd)); + if window= nil then raise exception.create('invalid window'); + threaddata := findthreaddata(window.threadid); + finally + structurelock.release; + end; + if threaddata.lcorethread then begin + getthreadmanager(tm); + if tm.GetCurrentThreadId <> window.threadid then raise exception.create('timers on the lcore thread may only be added and remove from the lcore thread'); + if ahwnd = 0 then raise exception.create('timers on the lcore thread must be associated with a window handle'); + ltimer := tltimerformsg(findtree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(uIDEvent))); + if ltimer <> nil then begin + deltree(@lcorethreadtimers,inttostr(taddrint(ahwnd))+' '+inttostr(uIDEvent)); + ltimer.free; + result := true; + end else begin + result := false; + end; + end else begin + raise exception.create('settimer not implemented for threads other than the lcore thread'); + end; +end; + +end. \ No newline at end of file diff --git a/lsignal.pas b/lsignal.pas new file mode 100755 index 0000000..49e51b2 --- /dev/null +++ b/lsignal.pas @@ -0,0 +1,201 @@ +{lsocket.pas} + +{signal code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit lsignal; +{$mode delphi} +interface + uses sysutils, + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, + {$endif} + classes,lcore,lloopback; + + type + tsignalevent=procedure(sender:tobject;signal:integer) of object; + tlsignal=class(tcomponent) + public + onsignal : tsignalevent ; + prevsignal : tlsignal ; + nextsignal : tlsignal ; + + constructor create(aowner:tcomponent);override; + destructor destroy;override; + end; + + + procedure starthandlesignal(signal:integer); + +var + firstsignal : tlsignal; + blockset : sigset; + signalloopback : tlloopback ; + +implementation +{$include unixstuff.inc} + +constructor tlsignal.create; +begin + inherited create(AOwner); + nextsignal := firstsignal; + prevsignal := nil; + + if assigned(nextsignal) then nextsignal.prevsignal := self; + firstsignal := self; + + //interval := 1000; + //enabled := true; + //released := false; +end; + +destructor tlsignal.destroy; +begin + if prevsignal <> nil then begin + prevsignal.nextsignal := nextsignal; + end else begin + firstsignal := nextsignal; + end; + if nextsignal <> nil then begin + nextsignal.prevsignal := prevsignal; + end; + inherited destroy; +end; +{$ifdef linux} + {$ifdef ver1_9_8} + {$define needsignalworkaround} + {$endif} + {$ifdef ver2_0_0} + {$define needsignalworkaround} + {$endif} + {$ifdef ver2_0_2} + {$define needsignalworkaround} + {$endif} +{$endif} +{$ifdef needsignalworkaround} + //using the 1.9.6 version of this stuff because the 1.9.8 and 2.0.0 versions seem broken + type + TSysParam = Longint; + TSysResult = longint; + const + syscall_nr_sigaction = 67; + //function Do_SysCall(sysnr:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL0'; + //function Do_SysCall(sysnr,param1:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL1'; + //function Do_SysCall(sysnr,param1,param2:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL2'; + function Do_SysCall(sysnr,param1,param2,param3:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL3'; + //function Do_SysCall(sysnr,param1,param2,param3,param4:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL4'; + //function Do_SysCall(sysnr,param1,param2,param3,param4,param5:TSysParam):TSysResult; {$ifndef VER1_0} oldfpccall; {$endif} external name 'FPC_SYSCALL5'; + + function Fpsigaction(sig: cint; act : psigactionrec; oact : psigactionrec): cint;// [public, alias : 'FPC_SYSC_SIGACTION']; + { + Change action of process upon receipt of a signal. + Signum specifies the signal (all except SigKill and SigStop). + If Act is non-nil, it is used to specify the new action. + If OldAct is non-nil the previous action is saved there. + } + begin + //writeln('fucking'); + {$ifdef RTSIGACTION} + {$ifdef cpusparc} + { Sparc has an extra stub parameter } + Fpsigaction:=do_syscall(syscall_nr_rt_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact),TSysParam(PtrInt(@Fprt_sigreturn_stub)-8),TSysParam(8)); + {$else cpusparc} + Fpsigaction:=do_syscall(syscall_nr_rt_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact),TSysParam(8)); + {$endif cpusparc} + {$else RTSIGACTION} + //writeln('nice'); + Fpsigaction:=do_syscall(syscall_nr_sigaction,TSysParam(sig),TSysParam(act),TSysParam(oact)); + {$endif RTSIGACTION} + end; +{$endif} + +// cdecl procedures are not name mangled +// so USING something unlikely to cause colliesions in the global namespace +// is a good idea +procedure lsignal_handler( Sig : Integer);cdecl; +var + currentsignal : tlsignal; +begin +// writeln('in lsignal_hanler'); + currentsignal := firstsignal; + while assigned(currentsignal) do begin + if assigned(currentsignal.onsignal) then currentsignal.onsignal(currentsignal,sig); + currentsignal := currentsignal.nextsignal; + + end; +// writeln('about to send down signalloopback'); + if assigned(signalloopback) then begin + signalloopback.sendstr(' '); + end; +// writeln('left lsignal_hanler'); +end; + +{$ifdef freebsd} + +{$if (FPC_VERSION > 2) or ((FPC_VERSION = 2) and (FPC_RELEASE >= 2))} +procedure lsignal_handler2(signal:longint;info:PSigInfo;context:psigcontext); cdecl; +{$else} +procedure lsignal_handler2(signal:longint;var info:TSigInfo_t;var context:SigContextRec); cdecl; +{$endif} + +begin + lsignal_handler(signal); +end; +{$endif} + + +const + allbitsset=-1; + {$ifdef ver1_0} + saction : sigactionrec = (handler:(sh:lsignal_handler);sa_flags:0); + {$else} + {$ifdef darwin} + saction : sigactionrec = (sa_handler:tsigaction(lsignal_handler);sa_flags:0); + {$else} + {$ifdef freebsd} + //version number is FPC_VERSION.FPC_RELEASE.FPC_PATCH + {$if (FPC_VERSION>2) or ((FPC_VERSION=2) and (FPC_RELEASE>0)) or ((FPC_VERSION=2) and (fpc_release=0) and (fpc_patch>=2))} + saction : sigactionrec = (sa_handler:lsignal_handler2;sa_flags:0); + {$else} + saction : sigactionrec = (sa_handler:tsigaction(lsignal_handler);sa_flags:0); + {$endif} + + {$else} + {$ifdef ver1_9_2} + saction : sigactionrec = (handler:(sh:lsignal_handler);sa_flags:0); + {$else} + //version number is FPC_VERSION.FPC_RELEASE.FPC_PATCH + {$if (FPC_VERSION>2) or ((FPC_VERSION=2) and (FPC_RELEASE>0)) or ((FPC_VERSION=2) and (fpc_release=0) and (fpc_patch>=2))} + saction : sigactionrec = (sa_handler:{$ifndef ver1_9_6}{$ifndef ver1_9_4}{$ifndef ver1_0}SigActionHandler{$endif}{$endif}{$endif}(lsignal_handler);sa_flags:0;sa_restorer:nil); + {$else} + saction : sigactionrec = (sa_handler:{$ifndef ver1_9_6}{$ifndef ver1_9_4}{$ifndef ver1_0}SigActionHandler{$endif}{$endif}{$endif}(lsignal_handler)); + {$endif} + {$endif} + {$endif} + {$endif} + {$endif} +procedure starthandlesignal(signal:integer); +begin + if signal in ([0..31]-[sigkill,sigstop]) then begin + sigprocmask(SIG_BLOCK,@blockset,nil); + sigaction(signal,@saction,nil) + end else begin + raise exception.create('invalid signal number') + end; +end; + +initialization + fillchar(blockset,sizeof(blockset),0); + blockset[0] := $FFFFFFFF - (1 shl sigstop) - (1 shl sigkill) - (1 shl sigsegv); + {$ifdef ver1_0} + saction.sa_mask := blockset[0]; + {$else} + saction.sa_mask := blockset; + {$endif} +end. diff --git a/lsocket.pas b/lsocket.pas new file mode 100755 index 0000000..58f157d --- /dev/null +++ b/lsocket.pas @@ -0,0 +1,706 @@ +{lsocket.pas} + +{socket code by plugwash} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +{ +changes by plugwash (20030728) +* created handlefdtrigger virtual method in tlasio (overridden in tlsocket) and moved a lot of code from messageloop into it +* changed tlasio to tlasio +* split fdhandle into fdhandlein and fdhandleout +* i now use fdsrmaster and fdswmaster instead of rebuilding the lists every loop +* split lsocket.pas into lsocket.pas and lcore.pas + + +changes by beware (20030903) +* added getxaddr, getxport (local addr, port, as string) +* added getpeername, remote addr+port as binary +* added htons and htonl functions (endian swap, same interface as windows API) + +beware (20030905) +* if connect failed (conn refused) set state to connected and call internalclose, to get closed handler (instead of fdclose) +* (lcore) if closing the fd's in internalcose, set fd's to -1 because closing an fd makes it invalid + +beware (20030927) +* fixed: on connect failed, tried to close fdhandle's which were already set to -1, added check + +beware (20031017) +* added getpeeraddr, getpeerport, remote addr+port as string +} + + +unit lsocket; +{$ifdef fpc} + {$mode delphi} +{$endif} +interface + uses + sysutils, + {$ifdef win32} + windows,winsock, + {$else} + + {$ifdef VER1_0} + linux, + {$else} + baseunix,unix,unixutil, + {$endif} + sockets, + {$endif} + classes,{pgdebugout,}pgtypes,lcore,fd_utils,binipstuff,dnssync; +type + sunB = packed record + s_b1, s_b2, s_b3, s_b4: byte; + end; + + SunW = packed record + s_w1, s_w2: word; + end; + + TInAddr = packed record + case integer of + 0: (S_un_b: SunB); + 1: (S_un_w: SunW); + 2: (S_addr: cardinal); + end; + {$ifdef ipv6} + {$ifdef ver1_0} + cuint16=word; + cuint32=dword; + sa_family_t=word; + + + TInetSockAddr6 = packed Record + sin6_family : sa_family_t; + sin6_port : cuint16; + sin6_flowinfo : cuint32; + sin6_addr : Tin6_addr; + sin6_scope_id : cuint32; + end; + {$endif} + {$endif} + TinetSockAddrv = packed record + case integer of + 0: (InAddr:TInetSockAddr); + {$ifdef ipv6} + 1: (InAddr6:TInetSockAddr6); + {$endif} + end; + Pinetsockaddrv = ^Tinetsockaddrv; + + + type + tsockaddrin=TInetSockAddr; + + type + TLsocket = class(tlasio) + public + //a: string; + + inAddr : TInetSockAddrV; +{ inAddrSize:integer;} + + //host : THostentry ; + + //mainthread : boolean ; //for debuggin only + addr:string; + port:string; + localaddr:string; + localport:string; + proto:string; + udp:boolean; + listenqueue:integer; + function getaddrsize:integer; + procedure connect; virtual; + procedure bindsocket; + procedure listen; + function accept : longint; + function sendto(dest:TInetSockAddr;destlen:integer;data:pointer;len:integer):integer; virtual; + function receivefrom(data:pointer;len:integer;var src:TInetSockAddr;var srclen:integer):integer; virtual; + //procedure internalclose(error:word);override; + procedure handlefdtrigger(readtrigger,writetrigger:boolean); override; + function send(data:pointer;len:integer):integer;override; + procedure sendstr(const str : string);override; + function Receive(Buf:Pointer;BufSize:integer):integer; override; + function getpeername(var addr:tsockaddrin;addrlen:integer):integer; virtual; + procedure getXaddrbin(var binip:tbinip); virtual; + procedure getpeeraddrbin(var binip:tbinip); virtual; + function getXaddr:string; virtual; + function getpeeraddr:string; virtual; + function getXport:string; virtual; + function getpeerport:string; virtual; + constructor Create(AOwner: TComponent); override; + {$ifdef win32} + procedure myfdclose(fd : integer); override; + function myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; override; + function myfdread(fd: LongInt;var buf;size: LongInt):LongInt; override; + {$endif} + end; + tsocket=longint; // for compatibility with twsocket + + twsocket=tlsocket; {easy} + +function htons(w:word):word; +function htonl(i:integer):integer; +{!!!function longipdns(s:string):longint;} + +{$ifdef ipv6} +const + v4listendefault:boolean=false; +{$endif} + + +const + TCP_NODELAY=1; + IPPROTO_TCP=6; + +implementation +{$include unixstuff.inc} + +function longip(s:string):longint;{$ifdef fpc}inline;{$endif} +var + l:longint; + a,b:integer; + +function convertbyte(const s:string):integer;{$ifdef fpc}inline;{$endif} +begin + result := strtointdef(s,-1); + if result < 0 then exit; + if result > 255 then exit; + + {01 exception} + if (result <> 0) and (s[1] = '0') then begin + result := -1; + exit; + end; + + {+1 exception} + if not (s[1] in ['0'..'9']) then begin + result := -1; + exit + end; +end; + +begin + result := 0; + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := b shl 24; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 16; + s := copy(s,a+1,256); + a := pos('.',s); + if a = 0 then exit; + b := convertbyte(copy(s,1,a-1));if (b < 0) then exit; + l := l or b shl 8; + s := copy(s,a+1,256); + b := convertbyte(copy(s,1,256));if (b < 0) then exit; + l := l or b; + result := l; +end; + +(*!!! +function longipdns(s:string):longint; +var + host : thostentry; +begin + if s = '0.0.0.0' then begin + result := 0; + end else begin + result := longip(s); + if result = 0 then begin + if gethostbyname(s,host) then begin; + result := htonl(Longint(Host.Addr)); + end; + //writeln(inttohex(longint(host.addr),8)) + end; + if result = 0 then begin + if resolvehostbyname(s,host) then begin; + result := htonl(Longint(Host.Addr)); + end; + //writeln(inttohex(longint(host.addr),8)) + end; + end; +end; +*) + + +function htons(w:word):word; +begin + {$ifndef ENDIAN_BIG} + result := ((w and $ff00) shr 8) or ((w and $ff) shl 8); + {$else} + result := w; + {$endif} +end; + +function htonl(i:integer):integer; +begin + {$ifndef ENDIAN_BIG} + result := (i shr 24) or (i shr 8 and $ff00) or (i shl 8 and $ff0000) or (i shl 24 and $ff000000); + {$else} + result := i; + {$endif} +end; + +function tlsocket.getaddrsize:integer; +begin + {$ifdef ipv6} + if inaddr.inaddr.family = AF_INET6 then result := sizeof(tinetsockaddr6) else + {$endif} + result := sizeof(tinetsockaddr); +end; + +function makeinaddrv(addr,port:string;var inaddr:tinetsockaddrv):integer; +var + biniptemp:tbinip; +begin + result := 0; + biniptemp := forwardlookup(addr,10); + fillchar(inaddr,sizeof(inaddr),0); + //writeln('converted address '+addr+' to binip '+ipbintostr(biniptemp)); + if biniptemp.family = AF_INET then begin + inAddr.InAddr.family:=AF_INET; + inAddr.InAddr.port:=htons(strtointdef(port,0)); + inAddr.InAddr.addr:=biniptemp.ip; + result := sizeof(tinetsockaddr); + end else + {$ifdef ipv6} + if biniptemp.family = AF_INET6 then begin + inAddr.InAddr6.sin6_family:=AF_INET6; + inAddr.InAddr6.sin6_port:=htons(strtointdef(port,0)); + inAddr.InAddr6.sin6_addr:=biniptemp.ip6; + result := sizeof(tinetsockaddr6); + end else + {$endif} + raise esocketexception.create('unable to resolve address: '+addr); +end; + +procedure tlsocket.connect; +var + a:integer; +begin + if state <> wsclosed then close; + //prevtime := 0; + makeinaddrv(addr,port,inaddr); + + udp := uppercase(proto) = 'UDP'; + if udp then a := SOCK_DGRAM else a := SOCK_STREAM; + a := Socket(inaddr.inaddr.family,a,0); + + //writeln(ord(inaddr.inaddr.family)); + if a = -1 then begin + lasterror := {$ifdef win32}getlasterror{$else}socketerror{$endif}; + raise esocketexception.create('unable to create socket'); + end; + try + dup(a); + bindsocket; + if udp then begin + {$ifndef win32} + SetSocketOptions(fdhandleout, SOL_SOCKET, SO_BROADCAST, 'TRUE', Length('TRUE')); + {$endif} + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + end else begin + state :=wsconnecting; + {$ifdef win32} + //writeln(inaddr.inaddr.port); + winsock.Connect(fdhandlein,winsock.psockaddr(@inADDR)^,getaddrsize); + {$else} + sockets.Connect(fdhandlein,inADDR,getaddrsize); + {$endif} + end; + eventcore.rmasterset(fdhandlein,false); + if udp then begin + eventcore.wmasterclr(fdhandleout); + end else begin + eventcore.wmasterset(fdhandleout); + end; + //sendq := ''; + except + on e: exception do begin + fdcleanup; + raise; //reraise the exception + end; + end; +end; + +procedure tlsocket.sendstr(const str : string); +begin + if udp then begin + send(@str[1],length(str)) + end else begin + inherited sendstr(str); + end; +end; + +function tlsocket.send(data:pointer;len:integer):integer; +begin + if udp then begin + //writeln('sending to '+inttohex(inaddr.inaddr.addr,8)); + result := sendto(inaddr.inaddr,getaddrsize,data,len) +; + //writeln('send result',result); + //writeln('errno',errno); + end else begin + result := inherited send(data,len); + end; +end; + + +function tlsocket.receive(Buf:Pointer;BufSize:integer):integer; +begin + if udp then begin + result := myfdread(self.fdhandlein,buf^,bufsize); + end else begin + result := inherited receive(buf,bufsize); + end; +end; + +procedure tlsocket.bindsocket; +var + a:integer; + inAddrtemp:TInetSockAddrV; + inAddrtempx:{$ifdef win32}winsock.TSockaddr{$else}TInetSockAddrV{$endif} absolute inaddrtemp; + inaddrtempsize:integer; +begin + try + if (localaddr <> '') or (localport <> '') then begin + if localaddr = '' then begin + {$ifdef ipv6} + if inaddr.inaddr.family = AF_INET6 then localaddr := '::' else + {$endif} + localaddr := '0.0.0.0'; + end; + //gethostbyname(localaddr,host); + + inaddrtempsize := makeinaddrv(localaddr,localport,inaddrtemp); + + If Bind(fdhandlein,inaddrtempx,inaddrtempsize)<> {$ifdef win32}0{$else}true{$endif} Then begin + state := wsclosed; + lasterror := {$ifdef win32}getlasterror{$else}socketerror{$endif}; + raise ESocketException.create('unable to bind, error '+inttostr(lasterror)); + end; + state := wsbound; + end; + except + on e: exception do begin + fdcleanup; + raise; //reraise the exception + end; + end; +end; + +procedure tlsocket.listen; +var + yes:longint; + socktype:integer; + biniptemp:tbinip; + origaddr:string; +begin + if state <> wsclosed then close; + udp := uppercase(proto) = 'UDP'; + if udp then socktype := SOCK_DGRAM else socktype := SOCK_STREAM; + origaddr := addr; + + if addr = '' then begin + {$ifdef ipv6} + if not v4listendefault then begin + addr := '::'; + end else + {$endif} + addr := '0.0.0.0'; + end; + biniptemp := forwardlookup(addr,10); + addr := ipbintostr(biniptemp); + fdhandlein := socket(biniptemp.family,socktype,0); + {$ifdef ipv6} + if (addr = '::') and (origaddr = '') and (fdhandlein < 0) then begin + addr := '0.0.0.0'; + fdhandlein := socket(AF_INET,socktype,0); + end; + {$endif} + if fdhandlein = -1 then raise ESocketException.create('unable to create socket'); + dupnowatch(fdhandlein); // sets up maxs and copies handle to fdhandleout among other things + //eventcore.setfdreverse(fdhandlein,self); //already taken care of by dup + state := wsclosed; // then set this back as it was an undesired side effect of dup + + try + yes := $01010101; {Copied this from existing code. Value is empiric, + but works. (yes=true<>0) } + {$ifndef win32} + if SetSocketOptions(fdhandlein, SOL_SOCKET, SO_REUSEADDR,yes,sizeof(yes))=-1 then begin + raise ESocketException.create('unable to set socket options'); + end; + {$endif} + localaddr := addr; + localport := port; + bindsocket; + + if not udp then begin + {!!! allow custom queue length? default 5} + if listenqueue = 0 then listenqueue := 5; + If {$ifdef win32}winsock{$else}sockets{$endif}.Listen(fdhandlein,listenqueue)<>{$ifdef win32}0{$else}true{$endif} Then raise esocketexception.create('unable to listen'); + state := wsListening; + end else begin + {$ifndef win32} + SetSocketOptions(fdhandleout, SOL_SOCKET, SO_BROADCAST, 'TRUE', Length('TRUE')); + {$endif} + state := wsconnected; + end; + finally + if state = wsclosed then begin + if fdhandlein >= 0 then begin + {one *can* get here without fd -beware} + eventcore.rmasterclr(fdhandlein); + myfdclose(fdhandlein); // we musnt leak file discriptors + eventcore.setfdreverse(fdhandlein,nil); + fdhandlein := -1; + end; + end else begin + eventcore.rmasterset(fdhandlein,true); + end; + if fdhandleout >= 0 then eventcore.wmasterclr(fdhandleout); + end; + //writeln('listened on addr '+addr+':'+port+' '+proto+' using socket number ',fdhandlein); +end; + +function tlsocket.accept : longint; +var + FromAddrSize : LongInt; // i don't realy know what to do with these at this + FromAddr : TInetSockAddrV; // at this point time will tell :) +begin + + FromAddrSize := Sizeof(FromAddr); + {$ifdef win32} + result := winsock.accept(fdhandlein,@fromaddr,@fromaddrsize); + {$else} + result := sockets.accept(fdhandlein,fromaddr,fromaddrsize); + {$endif} + //now we have accepted one request start monitoring for more again + eventcore.rmasterset(fdhandlein,true); + + if result = -1 then raise esocketexception.create('error '+inttostr({$ifdef win32}getlasterror{$else}socketerror{$endif})+' while accepting'); + if result > absoloutemaxs then begin + myfdclose(result); + result := -1; + raise esocketexception.create('file discriptor out of range'); + end; +end; + +function tlsocket.sendto(dest:TInetSockAddr;destlen:integer;data:pointer;len:integer):integer; +var + destx : {$ifdef win32}winsock.TSockAddr{$else}TInetSockAddr{$endif} absolute dest; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.sendto(self.fdhandleout,data^,len,0,destx,destlen); +end; + +function tlsocket.receivefrom(data:pointer;len:integer;var src:TInetSockAddr;var srclen:integer):integer; +var + srcx : {$ifdef win32}winsock.TSockAddr{$else}TInetSockAddr{$endif} absolute src; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.recvfrom(self.fdhandlein,data^,len,0,srcx,srclen); +end; + +procedure tlsocket.handlefdtrigger(readtrigger,writetrigger:boolean); +var + tempbuf:array[0..receivebufsize-1] of byte; +begin + //writeln('got a fd trigger, readtrigger=',readtrigger,' writetrigger=',writetrigger); + if (state =wslistening) and readtrigger then begin +{ debugout('listening socket triggered on read');} + eventcore.rmasterclr(fdhandlein); + if assigned(onsessionAvailable) then onsessionAvailable(self,0); + end; + if udp and readtrigger then begin + if assigned(ondataAvailable) then ondataAvailable(self,0); + {!!!test} + exit; + end; + if (state =wsconnecting) and writetrigger then begin + // code for dealing with the reults of a non-blocking connect is + // rather complex + // if just write is triggered it means connect suceeded + // if both read and write are triggered it can mean 2 things + // 1: connect ok and data availible + // 2: connect fail + // to find out which you must read from the socket and look for errors + // there if we read successfully we drop through into the code for fireing + // the read event + if not readtrigger then begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + end else begin + numread := myfdread(fdhandlein,tempbuf,sizeof(tempbuf)); + if numread <> -1 then begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,0); + //connectread := true; + recvq.add(@tempbuf,numread); + end else begin + state := wsconnected; + if assigned(onsessionconnected) then onsessionconnected(self,{$ifdef win32}wsagetlasterror{$else}linuxerror{$endif}); +{ debugout('connect fail');} + self.internalclose(0); + recvq.del(maxlongint); + end; + // if things went well here we are now in the state wsconnected with data sitting in our receive buffer + // so we drop down into the processing for data availible + end; + if fdhandlein >= 0 then begin + if state = wsconnected then begin + eventcore.rmasterset(fdhandlein,false); + end else begin + eventcore.rmasterclr(fdhandlein); + end; + end; + if fdhandleout >= 0 then begin + if sendq.size = 0 then begin + //don't clear the bit in fdswmaster if data is in the sendq + eventcore.wmasterclr(fdhandleout); + end; + end; + + end; + inherited handlefdtrigger(readtrigger,writetrigger); +end; + +constructor tlsocket.Create(AOwner: TComponent); +begin + inherited create(aowner); + closehandles := true; +end; + + +function tlsocket.getpeername(var addr:tsockaddrin;addrlen:integer):integer; +var + addrx : {$ifdef win32}winsock.tsockaddr{$else}tsockaddrin{$endif} absolute addr; +begin + result := {$ifdef win32}winsock{$else}sockets{$endif}.getpeername(self.fdhandlein,addrx,addrlen); +end; + +procedure tlsocket.getxaddrbin(var binip:tbinip); +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + fillchar(addr,sizeof(addr),0); + + {$ifdef win32} + winsock.getsockname(self.fdhandlein,psockaddr(@addr)^,i); + {$else} + sockets.getsocketname(self.fdhandlein,addr,i); + {$endif} + binip.family := addr.inaddr.family; + {$ifdef ipv6} + if addr.inaddr6.sin6_family = AF_INET6 then begin + binip.ip6 := addr.inaddr6.sin6_addr; + end else + {$endif} + begin + binip.ip := addr.inaddr.addr; + end; + converttov4(binip); +end; + +procedure tlsocket.getpeeraddrbin(var binip:tbinip); +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + fillchar(addr,sizeof(addr),0); + {$ifdef win32} + winsock.getpeername(self.fdhandlein,psockaddr(@addr)^,i); + {$else} + sockets.getpeername(self.fdhandlein,addr,i); + {$endif} + + binip.family := addr.inaddr.family; + {$ifdef ipv6} + if addr.inaddr6.sin6_family = AF_INET6 then begin + binip.ip6 := addr.inaddr6.sin6_addr; + end else + {$endif} + begin + binip.ip := addr.inaddr.addr; + end; + converttov4(binip); +end; + +function tlsocket.getXaddr:string; +var + biniptemp:tbinip; +begin + getxaddrbin(biniptemp); + result := ipbintostr(biniptemp); + if result = '' then result := 'error'; +end; + +function tlsocket.getpeeraddr:string; +var + biniptemp:tbinip; +begin + getpeeraddrbin(biniptemp); + result := ipbintostr(biniptemp); + if result = '' then result := 'error'; +end; + +function tlsocket.getXport:string; +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + {$ifdef win32} + winsock.getsockname(self.fdhandlein,psockaddrin(@addr)^,i); + + {$else} + sockets.getsocketname(self.fdhandlein,addr,i); + + {$endif} + result := inttostr(htons(addr.InAddr.port)); +end; + +function tlsocket.getpeerport:string; +var + addr:tinetsockaddrv; + i:integer; +begin + i := sizeof(addr); + {$ifdef win32} + winsock.getpeername(self.fdhandlein,psockaddrin(@addr)^,i); + + {$else} + sockets.getpeername(self.fdhandlein,addr,i); + + {$endif} + result := inttostr(htons(addr.InAddr.port)); +end; + +{$ifdef win32} + procedure tlsocket.myfdclose(fd : integer); + begin + closesocket(fd); + end; + function tlsocket.myfdwrite(fd: LongInt;const buf;size: LongInt):LongInt; + begin + result := winsock.send(fd,(@buf)^,size,0); + end; + function tlsocket.myfdread(fd: LongInt;var buf;size: LongInt):LongInt; + begin + result := winsock.recv(fd,buf,size,0); + end; +{$endif} + +end. + diff --git a/ltimevalstuff.inc b/ltimevalstuff.inc new file mode 100755 index 0000000..0ac92cb --- /dev/null +++ b/ltimevalstuff.inc @@ -0,0 +1,42 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + + + +{add nn msec to tv} +const + tv_invalidtimebig : ttimeval = (tv_sec:maxlongint;tv_usec:maxlongint); + //tv_invalidtimebig will always compare as greater than any valid timeval +procedure tv_add(var tv:ttimeval;msec:integer);//{ $ifdef fpc}inline;{ $endif} +begin + inc(tv.tv_usec,msec*1000); + inc(tv.tv_sec,tv.tv_usec div 1000000); + tv.tv_usec := tv.tv_usec mod 1000000; +end; + +{tv1 >= tv2} +function tv_compare(const tv1,tv2:ttimeval):boolean;//{ $ifdef fpc}inline;{ $endif} +begin + if tv1.tv_sec = tv2.tv_sec then begin + result := tv1.tv_usec >= tv2.tv_usec; + end else result := tv1.tv_sec > tv2.tv_sec; +end; + +procedure tv_substract(var tv:ttimeval;const tv2:ttimeval);//{ $ifdef fpc}inline;{ $endif} +begin + dec(tv.tv_usec,tv2.tv_usec); + if tv.tv_usec < 0 then begin + inc(tv.tv_usec,1000000); + dec(tv.tv_sec) + end; + dec(tv.tv_sec,tv2.tv_sec); +end; + +procedure msectotimeval(var tv:ttimeval;msec:integer); +begin + tv.tv_sec := msec div 1000; + tv.tv_usec := (msec mod 1000)*1000; +end; + diff --git a/pgtypes.pas b/pgtypes.pas new file mode 100755 index 0000000..3c48e26 --- /dev/null +++ b/pgtypes.pas @@ -0,0 +1,20 @@ +{io core originally for linux bworld} + +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit pgtypes; +interface + type + {$ifdef cpu386}{$define i386}{$endif} + {$ifdef i386} + taddrint=longint; + {$else} + taddrint=sizeint; + {$endif} + paddrint=^taddrint; + +implementation +end. diff --git a/svn-commit.2.tmp b/svn-commit.2.tmp new file mode 100755 index 0000000..82b4cd3 --- /dev/null +++ b/svn-commit.2.tmp @@ -0,0 +1,4 @@ +initial import +--This line, and those below, will be ignored-- + +A . diff --git a/svn-commit.3.tmp b/svn-commit.3.tmp new file mode 100755 index 0000000..82b4cd3 --- /dev/null +++ b/svn-commit.3.tmp @@ -0,0 +1,4 @@ +initial import +--This line, and those below, will be ignored-- + +A . diff --git a/svn-commit.4.tmp b/svn-commit.4.tmp new file mode 100755 index 0000000..6588c17 --- /dev/null +++ b/svn-commit.4.tmp @@ -0,0 +1,4 @@ +create directory +--This line, and those below, will be ignored-- + +A svn+ssh://p10link/svnroot/lcore/trunk diff --git a/svn-commit.5.tmp b/svn-commit.5.tmp new file mode 100755 index 0000000..82b4cd3 --- /dev/null +++ b/svn-commit.5.tmp @@ -0,0 +1,4 @@ +initial import +--This line, and those below, will be ignored-- + +A . diff --git a/svn-commit.tmp b/svn-commit.tmp new file mode 100755 index 0000000..82b4cd3 --- /dev/null +++ b/svn-commit.tmp @@ -0,0 +1,4 @@ +initial import +--This line, and those below, will be ignored-- + +A . diff --git a/uint32.inc b/uint32.inc new file mode 100755 index 0000000..897db79 --- /dev/null +++ b/uint32.inc @@ -0,0 +1,14 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } +type + {delphi 3 and before do not have a 32 bits unsigned integer type, + but longint has the correct behavior - it doesn't on newer delphi versions} + {$ifndef fpc} + {$ifdef ver70}{$define pred4}{$endif} {tp7} + {$ifdef ver80}{$define pred4}{$endif} {delphi 1} + {$ifdef ver90}{$define pred4}{$endif} {delphi 2} + {$ifdef ver100}{$define pred4}{$endif} {delphi 3} + {$endif} + uint32={$ifdef pred4}longint{$else}longword{$endif}; diff --git a/unixstuff.inc b/unixstuff.inc new file mode 100755 index 0000000..76a7f52 --- /dev/null +++ b/unixstuff.inc @@ -0,0 +1,76 @@ +{$ifdef UNIX} + {$macro on} + {$ifdef VER1_0} + {$define tv_sec := sec} + {$define tv_usec := usec} + function dup(const original:integer):integer;inline; + begin + linux.dup(original,result); + end; + {$define gettimeofdaysec := gettimeofday} + {$else} + + {$define sigprocmask := fpsigprocmask} + {$define sigaction := fpsigaction} + {$define fdclose := fpclose} + {$define fcntl := fpfcntl} + {$define fdwrite := fpwrite} + {$define fdread := fpread} + {$define fdopen := fpopen} + {$define select := fpselect} + {$define linuxerror := fpgeterrno} + {$define fork := fpfork} + {$define getpid := fpgetpid} + {$define getenv := fpgetenv} + {$define chmod := fpchmod} + {$define dup2 := fpdup2} + {$ifndef ver1_9_2} + {$define flock := fpflock} + {$ifndef ver1_9_4} + procedure Execl(Todo:string);inline; + var + p : ppchar; + begin + p := unixutil.StringToPPChar(Todo,1); + if (p=nil) or (p^=nil) then exit; + fpexecv(p^,p); + end; + {$endif} + {$endif} + procedure gettimeofday(var tv:ttimeval);inline; + begin + fpgettimeofday(@tv,nil); + end; + function gettimeofdaysec : longint; + var + tv:ttimeval; + begin + gettimeofday(tv); + result := tv.tv_sec; + end; + + //a function is used here rather than a define to prevent issues with tlasio.dup + function dup(const original:integer):integer;inline; + begin + result := fpdup(original); + end; + function octal(invalue:longint):longint; + var + a : integer; + i : integer; + begin + i := 0; + result := 0; + while invalue <> 0 do begin + a := invalue mod 10; + result := result + (a shl (i*3)); + + invalue := invalue div 10; + inc(i); + end; + end; + const + sys_eintr=esyseintr; + + {$endif} +{$endif} diff --git a/wcore.pas b/wcore.pas new file mode 100755 index 0000000..40505ef --- /dev/null +++ b/wcore.pas @@ -0,0 +1,372 @@ +{ Copyright (C) 2005 Bas Steendijk and Peter Green + For conditions of distribution and use, see copyright notice in zlib_license.txt + which is included in the package + ----------------------------------------------------------------------------- } + +unit wcore; + +{ +lcore compatible interface for windows + +- messageloop + +- tltimer + +} +//note: events after release are normal and are the apps responsibility to deal with safely +interface + + uses + classes,windows,mmsystem; + + type + float=double; + + tlcomponent = class(tcomponent) + public + released:boolean; + procedure release; + destructor destroy; override; + end; + + tltimer=class(tlcomponent) + public + ontimer:tnotifyevent; + initialevent:boolean; + initialdone:boolean; + prevtimer:tltimer; + nexttimer:tltimer; + interval:integer; {miliseconds, default 1000} + enabled:boolean; + nextts:integer; + constructor create(aowner:tcomponent);override; + destructor destroy;override; + end; + + ttaskevent=procedure(wparam,lparam:longint) of object; + + tltask=class(tobject) + public + handler : ttaskevent; + obj : tobject; + wparam : longint; + lparam : longint; + nexttask : tltask; + constructor create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); + end; + +procedure messageloop; +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +procedure disconnecttasks(aobj:tobject); +procedure exitmessageloop; +procedure processmessages; + +var + onshutdown:procedure(s:string); + +implementation + +uses + {$ifdef fpc} + bmessages; + {$else} + messages; + {$endif} + + +const + WINMSG_TASK=WM_USER; + +var + hwndwcore:hwnd; + firsttimer:tltimer; + timesubstract:integer; + firsttask,lasttask,currenttask:tltask; + +procedure tlcomponent.release; +begin + released := true; +end; + +destructor tlcomponent.destroy; +begin + disconnecttasks(self); + inherited destroy; +end; + +{------------------------------------------------------------------------------} + +constructor tltimer.create; +begin + inherited create(AOwner); + nexttimer := firsttimer; + prevtimer := nil; + + if assigned(nexttimer) then nexttimer.prevtimer := self; + firsttimer := self; + + interval := 1000; + enabled := true; + released := false; +end; + +destructor tltimer.destroy; +begin + if prevtimer <> nil then begin + prevtimer.nexttimer := nexttimer; + end else begin + firsttimer := nexttimer; + end; + if nexttimer <> nil then begin + nexttimer.prevtimer := prevtimer; + end; + inherited destroy; +end; + +{------------------------------------------------------------------------------} + +function wcore_timehandler:integer; +const + rollover_bits=30; +var + tv,tvnow:integer; + currenttimer,temptimer:tltimer; +begin + if not assigned(firsttimer) then begin + result := 1000; + exit; + end; + + tvnow := timegettime; + if (tvnow and ((-1) shl rollover_bits)) <> timesubstract then begin + currenttimer := firsttimer; + while assigned(currenttimer) do begin + dec(currenttimer.nextts,(1 shl rollover_bits)); + currenttimer := currenttimer.nexttimer; + end; + timesubstract := tvnow and ((-1) shl rollover_bits); + end; + tvnow := tvnow and ((1 shl rollover_bits)-1); + + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if tvnow >= currenttimer.nextts then begin + if assigned(currenttimer.ontimer) then begin + if currenttimer.enabled then begin + if currenttimer.initialevent or currenttimer.initialdone then currenttimer.ontimer(currenttimer); + currenttimer.initialdone := true; + end; + end; + currenttimer.nextts := tvnow+currenttimer.interval; + end; + temptimer := currenttimer; + currenttimer := currenttimer.nexttimer; + if temptimer.released then temptimer.free; + end; + + tv := maxlongint; + currenttimer := firsttimer; + while assigned(currenttimer) do begin + if currenttimer.nextts < tv then tv := currenttimer.nextts; + currenttimer := currenttimer.nexttimer; + end; + result := tv-tvnow; + if result < 15 then result := 15; +end; + +{------------------------------------------------------------------------------} + +constructor tltask.create(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + inherited create; + handler := ahandler; + obj := aobj; + wparam := awparam; + lparam := alparam; + {nexttask := firsttask; + firsttask := self;} + if assigned(lasttask) then begin + lasttask.nexttask := self; + end else begin + firsttask := self; + postmessage(hwndwcore,WINMSG_TASK,0,0); + end; + lasttask := self; + //ahandler(wparam,lparam); +end; + +procedure addtask(ahandler:ttaskevent;aobj:tobject;awparam,alparam:longint); +begin + tltask.create(ahandler,aobj,awparam,alparam); +end; + +procedure disconnecttasks(aobj:tobject); +var + currenttasklocal : tltask ; + counter : byte ; +begin + for counter := 0 to 1 do begin + if counter = 0 then begin + currenttasklocal := firsttask; //main list of tasks + end else begin + currenttasklocal := currenttask; //needed in case called from a task + end; + // note i don't bother to sestroy the links here as that will happen when + // the list of tasks is processed anyway + while assigned(currenttasklocal) do begin + if currenttasklocal.obj = aobj then begin + currenttasklocal.obj := nil; + currenttasklocal.handler := nil; + end; + currenttasklocal := currenttasklocal.nexttask; + end; + end; +end; + +procedure dotasks; +var + temptask:tltask; +begin + if firsttask = nil then exit; + + currenttask := firsttask; + firsttask := nil; + lasttask := nil; + while assigned(currenttask) do begin + if assigned(currenttask.handler) then currenttask.handler(currenttask.wparam,currenttask.lparam); + temptask := currenttask; + currenttask := currenttask.nexttask; + temptask.free; + end; + currenttask := nil; +end; + +{------------------------------------------------------------------------------} + +procedure exitmessageloop; +begin + postmessage(hwndwcore,WM_QUIT,0,0); +end; + + {$ifdef threadtimer} + 'thread timer' + {$else} +const timerid_wcore=$1000; + {$endif} + +function MyWindowProc( + ahWnd : HWND; + auMsg : Integer; + awParam : WPARAM; + alParam : LPARAM): Integer; stdcall; +var + MsgRec : TMessage; + a:integer; +begin + Result := 0; // This means we handled the message + + {MsgRec.hwnd := ahWnd;} + MsgRec.wParam := awParam; + MsgRec.lParam := alParam; + + dotasks; + case auMsg of + {$ifndef threadtimer} + WM_TIMER: begin + if msgrec.wparam = timerid_wcore then begin + a := wcore_timehandler; + killtimer(hwndwcore,timerid_wcore); + settimer(hwndwcore,timerid_wcore,a,nil); + end; + end; + {$endif} + + {WINMSG_TASK:dotasks;} + + WM_CLOSE: begin + {} + end; + WM_DESTROY: begin + {} + end; + else + Result := DefWindowProc(ahWnd, auMsg, awParam, alParam) + end; +end; + + +var + MyWindowClass : TWndClass = (style : 0; + lpfnWndProc : @MyWindowProc; + cbClsExtra : 0; + cbWndExtra : 0; + hInstance : 0; + hIcon : 0; + hCursor : 0; + hbrBackground : 0; + lpszMenuName : nil; + lpszClassName : 'wcoreClass'); + +procedure messageloop; +var + MsgRec : TMsg; +begin + + if Windows.RegisterClass(MyWindowClass) = 0 then halt; + //writeln('about to create wcore handle, hinstance=',hinstance); + hwndwcore := CreateWindowEx(WS_EX_TOOLWINDOW, + MyWindowClass.lpszClassName, + '', { Window name } + WS_POPUP, { Window Style } + 0, 0, { X, Y } + 0, 0, { Width, Height } + 0, { hWndParent } + 0, { hMenu } + HInstance, { hInstance } + nil); { CreateParam } + + if hwndwcore = 0 then halt; + + {$ifdef threadtimer} + 'thread timer' + {$else} + if settimer(hwndwcore,timerid_wcore,15,nil) = 0 then halt; + {$endif} + + + while GetMessage(MsgRec, 0, 0, 0) do begin + TranslateMessage(MsgRec); + DispatchMessage(MsgRec); + {if not peekmessage(msgrec,0,0,0,PM_NOREMOVE) then onidle} + end; + + if hWndwcore <> 0 then begin + DestroyWindow(hwndwcore); + hWndwcore := 0; + end; + + {$ifdef threadtimer} + 'thread timer' + {$else} + killtimer(hwndwcore,timerid_wcore); + {$endif} +end; + +function ProcessMessage : Boolean; +var + Msg : TMsg; +begin + Result := FALSE; + if PeekMessage(Msg, hwndwcore, 0, 0, PM_REMOVE) then begin + Result := TRUE; + DispatchMessage(Msg); + end; +end; + +procedure processmessages; +begin + while processmessage do; +end; + + +end.